Brand: ProteoGenix

Human BST2 Recombinant Protein

PX-P3037-20
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q10589
Molecular weight:: 39.49 kDa

Original price was: €193.00.Current price is: €175.00.

20ug 9% OFF + 175 loyalty points

Partial Yes

Size Size

20ug Original price was: €193.00.Current price is: €175.00.
50ug Original price was: €271.00.Current price is: €210.00.
100ug Original price was: €378.00.Current price is: €329.00.
1MG Original price was: €1,059.00.Current price is: €954.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human BST2 Recombinant Protein

Product name	Human BST2 Recombinant Protein
Uniprot ID	Q10589
Uniprot link	http://www.uniprot.org/uniprot/Q10589
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight	39.49 kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Spec:Entrez GeneID	BST2
NCBI Reference	Q10589
Aliases /Synonyms	HM1.24 antigen, Tetherin, CD317
Reference	PX-P3037
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human BST2 Recombinant Protein
Uniprot ID	Q10589
Uniprot link	http://www.uniprot.org/uniprot/Q10589
Origin species	Homo sapiens (Human)
Expression system	Procaryotic expression
Raw Antigen Sequence	SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight	39.49 kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Spec:Entrez GeneID	BST2
NCBI Reference	Q10589
Aliases /Synonyms	HM1.24 antigen, Tetherin, CD317
Reference	PX-P3037
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human BST2 Recombinant Protein
Uniprot ID	Q10589
Uniprot link	http://www.uniprot.org/uniprot/Q10589
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight	39.49 kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Spec:Entrez GeneID	BST2
NCBI Reference	Q10589
Aliases /Synonyms	HM1.24 antigen, Tetherin, CD317
Reference	PX-P3037
Note	For research use only
Molecular Constructor	Partial Yes

Product name	PX-P3037-1MG
Uniprot ID	Q10589
Uniprot link	http://www.uniprot.org/uniprot/Q10589
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight	39.49 kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Spec:Entrez GeneID	BST2
NCBI Reference	Q10589
Aliases /Synonyms	HM1.24 antigen, Tetherin, CD317
Reference	PX-P3037
Note	For research use only
Molecular Constructor	Partial Yes