Brand: ProteoGenix

Human BCL2A1 Recombinant Protein, N-GST & C-His

ARO-P20209-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: Q16548
Molecular weight:: 46.82 kDa

Original price was: €294.00.Current price is: €228.00.

50ug 22% OFF + 228 loyalty points

GST Met1–Cys175 His

Size Size

50ug Original price was: €294.00.Current price is: €228.00.
100ug Original price was: €403.00.Current price is: €325.00.
1MG Original price was: €1,056.00.Current price is: €943.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Human BCL2A1 Recombinant Protein, N-GST & C-His

Product name	ARO-P20209-100
Uniprot ID	Q16548
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
Molecular weight	46.82 kDa
Protein delivered with Tag?	N-Terminal GST and C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Cys175
Aliases /Synonyms	BCL2A1, BCL2L5, BFL1, Bcl-2-like protein 5, Bcl-2-related protein A1, Bcl2-L-5, GRS, HBPA1, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS
Reference	ARO-P20209
Note	For research use only.
Molecular Constructor	GST Met1–Cys175 His

Product name	ARO-P20209-1MG
Uniprot ID	Q16548
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
Molecular weight	46.82 kDa
Protein delivered with Tag?	N-Terminal GST and C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Cys175
Aliases /Synonyms	BCL2A1, BCL2L5, BFL1, Bcl-2-like protein 5, Bcl-2-related protein A1, Bcl2-L-5, GRS, HBPA1, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS
Reference	ARO-P20209
Note	For research use only.
Molecular Constructor	GST Met1–Cys175 His

Product name	ARO-P20209-50
Uniprot ID	Q16548
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
Molecular weight	46.82 kDa
Protein delivered with Tag?	N-Terminal GST and C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Cys175
Aliases /Synonyms	BCL2A1, BCL2L5, BFL1, Bcl-2-like protein 5, Bcl-2-related protein A1, Bcl2-L-5, GRS, HBPA1, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS
Reference	ARO-P20209
Note	For research use only.
Molecular Constructor	GST Met1–Cys175 His