Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DOCK4, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N1I0
Molecular weight:
37.29 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Met1–Pro300
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DOCK4, N-His

Product name ARO-P13254-100
Uniprot ID Q8N1I0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSSYVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITELYRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
Molecular weight 37.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro300
Aliases /Synonyms DOCK4, KIAA0716, Dedicator of cytokinesis protein 4
Reference ARO-P13254
Note For research use only.
Molecular Constructor
Met1–Pro300
Product name ARO-P13254-1MG
Uniprot ID Q8N1I0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSSYVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITELYRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
Molecular weight 37.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro300
Aliases /Synonyms DOCK4, KIAA0716, Dedicator of cytokinesis protein 4
Reference ARO-P13254
Note For research use only.
Molecular Constructor
Met1–Pro300
Product name ARO-P13254-50
Uniprot ID Q8N1I0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSSYVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITELYRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
Molecular weight 37.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro300
Aliases /Synonyms DOCK4, KIAA0716, Dedicator of cytokinesis protein 4
Reference ARO-P13254
Note For research use only.
Molecular Constructor
Met1–Pro300

Introduction

Recombinant Human DOCK4 (Rho guanine nucleotide exchange factor 2) is a protein that plays an important role in cell signaling and cytoskeletal dynamics. It is encoded by the DOCK4 gene and is a member of the DOCK family of proteins. Recombinant Human DOCK4 is produced through genetic engineering techniques and has many applications in the fields of research, diagnostics, and therapeutics.

Structure of Recombinant Human DOCK4

Recombinant Human DOCK4 is a large protein with a molecular weight of approximately 200 kDa. It consists of several structural domains including a DHR-1 domain, a DHR-2 domain, a PH domain, and a SH3 domain. The DHR-1 and DHR-2 domains are responsible for the guanine nucleotide exchange activity of DOCK4, while the PH and SH3 domains are involved in protein-protein interactions.

DHR-1 and DHR-2 domains

The DHR-1 and DHR-2 domains of Recombinant Human DOCK4 are responsible for its guanine nucleotide exchange activity. They bind to Rho family GTPases and facilitate the exchange of GDP for GTP, leading to the activation of these small GTPases. This activity is crucial for regulating cell signaling pathways and cytoskeletal dynamics.

PH domain

The PH domain of Recombinant Human DOCK4 is a lipid-binding domain that is important for its subcellular localization. It binds to phosphoinositides, which are lipids found in the cell membrane, and helps target DOCK4 to specific regions of the cell where it can carry out its function.

SH3 domain

The SH3 domain of Recombinant Human DOCK4 is a protein-protein interaction domain. It binds to proline-rich sequences in other proteins and plays a role in the formation of protein complexes. This domain is important for the regulation of DOCK4 activity and its interaction with other signaling molecules.

Activity of Recombinant Human DOCK4

Recombinant Human DOCK4 is a key regulator of cell signaling pathways and cytoskeletal dynamics. It is involved in a variety of cellular processes such as cell migration, cell adhesion, and cell proliferation. Its guanine nucleotide exchange activity on Rho family GTPases is crucial for the coordination of these processes.

One of the main functions of Recombinant Human DOCK4 is its role in cell migration. It promotes the formation of lamellipodia, which are dynamic protrusions at the leading edge of migrating cells. This is achieved through the activation of Rho family GTPases, which play a critical role in the regulation of actin dynamics.

In addition, Recombinant Human DOCK4 is also involved in cell adhesion. It promotes the formation of focal adhesions, which are specialized structures that link the cell to the extracellular matrix. This is important for maintaining cell-cell and cell-matrix interactions, as well as for cell survival and proliferation.

Application of Recombinant Human DOCK4

Recombinant Human DOCK4 has many applications in the fields of research, diagnostics, and therapeutics. Its role in cell signaling and cytoskeletal dynamics makes it a valuable tool for studying cellular processes such as cell migration, adhesion, and proliferation.

In research, Recombinant Human DOCK4 is used to study the function and regulation of Rho family GTPases. It can also be used to investigate the role of DOCK4 in specific cellular processes and to identify potential therapeutic targets.

In diagnostics, Recombinant Human DOCK4 can be used as an antigen in immunoassays to detect the presence of antibodies against DOCK4. This can be useful in diagnosing autoimmune diseases and other disorders related to DOCK4.

In therapeutics, Recombinant Human DOCK4 has potential as a target for drug development. Its involvement

Recombinant Human DOCK4, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DOCK4, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products