Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL29/IFNL1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IU54
Molecular weight:
22.32 kDa

Original price was: €428.00.Current price is: €329.00.

100ug 23% OFF + 329 loyalty points
Gly20–Thr200
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL29/IFNL1, N-His

Product name ARO-P13259-100
Uniprot ID Q8IU54
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Molecular weight 22.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Thr200
Aliases /Synonyms ZCYTO21, Cytokine Zcyto21, IFNL1, Interferon lambda-1, IL-29, IFN-lambda-1, Interleukin-29, IL29
Reference ARO-P13259
Note For research use only.
Molecular Constructor
Gly20–Thr200
Product name ARO-P13259-1MG
Uniprot ID Q8IU54
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Molecular weight 22.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Thr200
Aliases /Synonyms ZCYTO21, Cytokine Zcyto21, IFNL1, Interferon lambda-1, IL-29, IFN-lambda-1, Interleukin-29, IL29
Reference ARO-P13259
Note For research use only.
Molecular Constructor
Gly20–Thr200
Product name ARO-P13259-50
Uniprot ID Q8IU54
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Molecular weight 22.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Thr200
Aliases /Synonyms ZCYTO21, Cytokine Zcyto21, IFNL1, Interferon lambda-1, IL-29, IFN-lambda-1, Interleukin-29, IL29
Reference ARO-P13259
Note For research use only.
Molecular Constructor
Gly20–Thr200

Introduction to Recombinant Human IL29/IFNL1

Recombinant Human IL29/IFNL1, also known as Interferon lambda 1, is a type III interferon protein that plays a crucial role in the immune response against viral infections. This protein is produced through recombinant DNA technology, making it a highly purified and biologically active form of the naturally occurring human IL29/IFNL1.

Structure of Recombinant Human IL29/IFNL1

Recombinant Human IL29/IFNL1 is a glycoprotein consisting of 200 amino acids with a molecular weight of approximately 22 kDa. It belongs to the family of type III interferons, which also includes IL28A and IL28B. The protein has a similar structure to other interferons, with a four-helix bundle motif and a conserved cysteine residue at the C-terminus. It also contains three N-linked glycosylation sites, which are crucial for its stability and biological activity.

Activity of Recombinant Human IL29/IFNL1

Recombinant Human IL29/IFNL1 exerts its biological activity by binding to the heterodimeric receptor complex consisting of the IL10R2 and IL28RA subunits. This binding leads to the activation of the JAK-STAT signaling pathway, resulting in the induction of various antiviral genes. These genes play a crucial role in inhibiting viral replication and promoting the immune response against viral infections.

Recombinant Human IL29/IFNL1 has been shown to have potent antiviral activity against a wide range of viruses, including hepatitis C virus, influenza virus, and respiratory syncytial virus. It also exhibits antitumor activity by inhibiting the growth and proliferation of cancer cells. Additionally, this protein has been found to have immunomodulatory effects, such as enhancing the maturation and activation of dendritic cells and promoting the production of cytokines and chemokines.

Application of Recombinant Human IL29/IFNL1

The unique properties of Recombinant Human IL29/IFNL1 make it a valuable tool in various research and clinical applications. One of the main applications of this protein is in the development of antiviral therapies. Due to its potent antiviral activity, Recombinant Human IL29/IFNL1 has been investigated as a potential treatment for viral infections, such as hepatitis C and influenza. It has also shown promising results in combination therapy with other antiviral drugs, leading to improved treatment outcomes.

Furthermore, Recombinant Human IL29/IFNL1 has been used in cancer research as a potential immunotherapeutic agent. Its ability to inhibit tumor growth and stimulate the immune system makes it a promising candidate for cancer treatment. It has also been studied for its potential in treating autoimmune diseases, such as psoriasis and multiple sclerosis, due to its immunomodulatory effects.

In addition to its therapeutic applications, Recombinant Human IL29/IFNL1 is also used as a research tool in various studies. It is commonly used in in vitro and in vivo experiments to investigate the mechanisms of viral infections and the immune response. It is also used in the development of diagnostic assays for viral infections, as well as in the production of antibodies for IL29/IFNL1 detection.

Conclusion

Recombinant Human IL29/IFNL1 is a highly purified and biologically active form of the naturally occurring human IL29/IFNL1. Its unique structure and biological activity make it a valuable tool in various research and clinical applications. From antiviral therapy to cancer research, this protein has shown great potential in treating and understanding various diseases. As research on Recombinant Human IL29/IFNL1 continues, it is expected to have an even more significant impact on the fields of immunology and viro

Recombinant Human IL29/IFNL1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL29/IFNL1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products