Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA1949-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Gotistobart Biosimilar - Anti-CD152 mAb - Research Grade

Product name Gotistobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2226344-78-9
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1949
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Gotistobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2226344-78-9
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1949
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1949-50
Uniprot ID P16410
Source CAS: 2226344-78-9
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1949
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade is a novel therapeutic antibody that has been developed to target CD152, a protein that plays a critical role in regulating the immune response. This biosimilar is a highly specific and potent monoclonal antibody that has been designed to mimic the activity of the existing anti-CD152 mAb, while also providing improved efficacy and safety profiles. In this article, we will provide a comprehensive overview of the structure, activity, and application of Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade.

Structure of Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade

Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade is a recombinant monoclonal antibody that has been produced using advanced biotechnology techniques. It is a fully humanized IgG1 antibody, which means that it has been engineered to minimize immunogenicity and improve its therapeutic potential. The antibody is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The variable regions of the antibody are responsible for its specificity and binding to the target protein, CD152.

Activity of Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade

The primary function of Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade is to block the activity of CD152, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4). CD152 is a protein that is expressed on the surface of T cells and plays a key role in regulating the immune response. It acts as a negative regulator, preventing T cells from becoming overactive and causing damage to healthy tissues. However, in certain diseases such as cancer, CD152 can be overexpressed, leading to an impaired immune response. Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade binds to CD152 and blocks its activity, allowing the immune system to function more effectively in fighting diseases.

Application of Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade

Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade is primarily being developed as a treatment for various types of cancer, including melanoma, non-small cell lung cancer, and renal cell carcinoma. By targeting CD152, this biosimilar can enhance the immune response against cancer cells, leading to improved outcomes for patients. It is also being investigated for its potential in treating autoimmune diseases such as rheumatoid arthritis and inflammatory bowel disease, where an overactive immune system can cause damage to healthy tissues.

Advantages of Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade

Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade offers several advantages over existing anti-CD152 mAbs. Firstly, it is a biosimilar, which means that it has been developed to be highly similar to the reference product in terms of structure, activity, and efficacy. This ensures that it is as safe and effective as the original product. Additionally, being a fully humanized antibody, it has a lower risk of causing adverse reactions in patients. Finally, its improved efficacy and safety profiles make it a promising candidate for the treatment of various diseases.

Conclusion

In conclusion, Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade is a novel therapeutic antibody that targets CD152, a protein involved in regulating the immune response. Its advanced structure, potent activity, and potential applications in cancer and autoimmune diseases make it a promising candidate for future treatments. Further research and clinical trials will provide more insights into the efficacy and safety of this biosimilar, paving the way for its use in clinical practice.

Research Grade Gotistobart binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Gotistobart binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Gotistobart in indirect ELISA with Goat secondary antibody measured by OD450.

Gotistobart Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products