Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Golimumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Golimumab ELISA Kit

Golimumab ELISA Kit

Product name Golimumab ELISA Kit
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX129
Note For research use only.
Sample type Plasma, Serum
Target Golimumab
Immunogen Golimumab

Golimumab ELISA Kit: A Powerful Tool for Detecting and Quantifying Golimumab in Biological Samples Golimumab is a monoclonal antibody that has been developed as a therapeutic agent for treating autoimmune disorders such as rheumatoid arthritis, psoriatic arthritis, and ankylosing spondylitis. It works by binding to a specific protein called tumor necrosis factor alpha (TNF-α), which plays a key role in the inflammatory response. By blocking the action of TNF-α, golimumab helps reduce inflammation and alleviate symptoms of these diseases.

As with any therapeutic agent, it is important to accurately measure the levels of golimumab in a patient’s body to ensure proper dosing and treatment efficacy. This is where the Golimumab ELISA Kit comes into play. ELISA (enzyme-linked immunosorbent assay) is a widely used technique for detecting and quantifying specific proteins in biological samples. The Golimumab ELISA Kit is a powerful tool that utilizes this technique to detect and quantify golimumab in various biological samples, such as serum, plasma, and cell culture supernatants.

Structure of the Golimumab ELISA Kit

The Golimumab ELISA Kit consists of several components, including microtiter plates coated with a specific antibody against golimumab, golimumab standards, and detection reagents. The microtiter plates are pre-coated with the capture antibody, which specifically binds to golimumab. The standards are used to generate a standard curve for quantification of golimumab in the samples. The detection reagents include an enzyme-labeled golimumab and a substrate that produces a colorimetric signal when acted upon by the enzyme.

The principle of the Golimumab ELISA Kit is based on the specific binding of golimumab to the capture antibody on the microtiter plate. Any golimumab present in the sample will bind to the capture antibody, while any unbound proteins are washed away. The enzyme-labeled golimumab is then added, which binds to the captured golimumab. The substrate is then added, and the color change is measured using a spectrophotometer. The intensity of the color is directly proportional to the amount of golimumab present in the sample, allowing for accurate quantification.

Activity of the Golimumab ELISA Kit

The Golimumab ELISA Kit has a high sensitivity and specificity for golimumab, meaning it can accurately detect and quantify very low levels of golimumab in biological samples. It has a wide dynamic range, allowing for the measurement of golimumab at various concentrations. The kit also has a high reproducibility, with low intra- and inter-assay variability. This ensures that results obtained from different experiments or different operators are consistent and reliable.

The Golimumab ELISA Kit is also a rapid and convenient method for golimumab detection, with a total assay time of less than 4 hours. This makes it a valuable tool for high-throughput screening of samples in research and clinical settings.

Application of the Golimumab ELISA Kit

The Golimumab ELISA Kit has a wide range of applications in both research and clinical settings. It can be used to measure golimumab levels in patient samples to monitor treatment efficacy and guide dosing decisions. It is also a valuable tool for studying the pharmacokinetics of golimumab, as it allows for the measurement of drug levels in various biological matrices over time.

In addition, the Golimumab ELISA Kit can be used in pre-clinical studies to assess the pharmacokinetics and immunogenicity of golimumab in animal models. It can also be used to measure golimumab levels in cell culture supernatants, which is useful for optimizing cell-based assays and studying the mechanism of action of golimumab.

In Conclusion

The Golimumab ELISA Kit is a

Golimumab ELISA Kit

There are no reviews yet.

Be the first to review “Golimumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products