Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Giloralimab Biosimilar – Anti-CD40 mAb – Research Grade

  • PX-TA1845-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Giloralimab Biosimilar - Anti-CD40 mAb - Research Grade

Product name Giloralimab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Giloralimab,,CD40,anti-CD40
Reference PX-TA1845
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Giloralimab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Giloralimab,,CD40,anti-CD40
Reference PX-TA1845
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1845-50
Uniprot ID P25942
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Giloralimab,,CD40,anti-CD40
Reference PX-TA1845
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Giloralimab Biosimilar: A Promising Anti-CD40 mAb for Therapeutic Targeting Introduction

Giloralimab Biosimilar is a novel monoclonal antibody (mAb) that specifically targets CD40, a protein expressed on the surface of immune cells. This biosimilar is being developed as a potential therapeutic agent for various inflammatory and autoimmune diseases. In this article, we will discuss the structure, activity, and potential applications of Giloralimab Biosimilar in the field of immunotherapy.

Structure of Giloralimab Biosimilar

Giloralimab Biosimilar is a humanized IgG1 monoclonal antibody that is produced in Chinese hamster ovary (CHO) cells. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The variable regions of the antibody are derived from a murine anti-CD40 antibody, while the constant regions are of human origin. This structure allows for optimal binding to the CD40 protein, while minimizing the potential for immunogenicity in humans.

Mechanism of Action

Giloralimab Biosimilar works by binding to CD40, a co-stimulatory receptor found on the surface of immune cells such as B cells, dendritic cells, and macrophages. CD40 plays a crucial role in the activation and differentiation of these immune cells, making it an attractive therapeutic target for various diseases. By binding to CD40, Giloralimab Biosimilar blocks its interaction with its ligand, CD154, thereby inhibiting the downstream signaling pathways involved in immune cell activation and inflammation.

Applications of Giloralimab Biosimilar

1. Inflammatory Bowel Disease (IBD): IBD is a chronic inflammatory condition of the gastrointestinal tract, which includes Crohn’s disease and ulcerative colitis. CD40 has been implicated in the pathogenesis of IBD, and studies have shown that blocking CD40 signaling can ameliorate the symptoms of IBD. Giloralimab Biosimilar has shown promising results in preclinical studies for the treatment of IBD and is currently being evaluated in clinical trials.

2. Rheumatoid Arthritis (RA): RA is an autoimmune disease characterized by chronic inflammation of the joints. CD40 has been shown to play a critical role in the activation of immune cells in RA, leading to joint destruction and inflammation. Giloralimab Biosimilar has demonstrated efficacy in preclinical models of RA and is currently being evaluated in clinical trials as a potential treatment for this debilitating disease.

3. Systemic Lupus Erythematosus (SLE): SLE is a systemic autoimmune disease that can affect multiple organs, including the skin, joints, and kidneys. CD40 has been implicated in the pathogenesis of SLE, and studies have shown that blocking CD40 signaling can reduce disease severity. Giloralimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of SLE.

4. Solid Tumors: CD40 is also expressed on the surface of tumor cells and has been shown to play a role in tumor growth and progression. By targeting CD40, Giloralimab Biosimilar has the potential to not only inhibit tumor growth but also activate the immune system to attack cancer cells. Clinical trials are currently underway to evaluate the efficacy of Giloralimab Biosimilar in various solid tumors.

Conclusion

In summary, Giloralimab Biosimilar is a promising anti-CD40 mAb that has shown efficacy in preclinical studies for the treatment of various inflammatory and autoimmune diseases. Its unique structure and mechanism of action make it a potential therapeutic agent for a broad range of conditions. With ongoing clinical trials, Giloralimab Biosimilar has the potential to become a valuable addition to the field of immunotherapy.

Flow Cytometry results for Giloralimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow Cytometry results for Giloralimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow-cytometry using APC anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD40 monoclonal antibody (Catalog: PX-TA1845, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Giloralimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow Cytometry results for Giloralimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow-cytometry using FITC anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CD40 monoclonal antibody (Catalog: PX-TA1845, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Giloralimab Biosimilar - Anti-CD40 mAb - Research Grade

There are no reviews yet.

Be the first to review “Giloralimab Biosimilar – Anti-CD40 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products