Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Frunevetmab Biosimilar – Anti-NGF, NGFB mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €169.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Frunevetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade

Product name Frunevetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID Q6ZY27
Source CAS 1708936-80-4
Species Felinized
Expression system Mammalian cells
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Frunevetmab,NV-02,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1461
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Frunevetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID Q6ZY27
Source CAS 1708936-80-4
Species Felinized
Expression system Mammalian cells
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Frunevetmab,NV-02,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1461
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1461-50
Uniprot ID Q6ZY27
Source CAS 1708936-80-4
Species Felinized
Expression system Mammalian cells
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Frunevetmab,NV-02,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1461
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Frunevetmab Biosimilar, also known as Anti-NGF, NGFB mAb – Research Grade, is a monoclonal antibody (mAb) that has been developed as a biosimilar to the therapeutic antibody, Frunevetmab. It is designed to target and inhibit the activity of nerve growth factor (NGF), a protein that plays a critical role in the development and maintenance of the nervous system. In this article, we will explore the structure, activity, and potential applications of Frunevetmab Biosimilar.

Structure of Frunevetmab Biosimilar

Frunevetmab Biosimilar is a recombinant, fully humanized mAb that is produced using a cell line derived from human embryonic kidney cells. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 150 kDa. The heavy and light chains are connected by disulfide bonds and form a Y-shaped structure. The variable regions of the antibody, which are responsible for binding to NGF, are located at the tips of the Y-shaped structure.

Activity of Frunevetmab Biosimilar

As a biosimilar to Frunevetmab, Frunevetmab Biosimilar has the same mechanism of action. It binds specifically to NGF and prevents it from interacting with its receptors, TrkA and p75NTR. This inhibition of NGF activity leads to a decrease in pain signaling and inflammation, making it a potential therapeutic option for conditions such as osteoarthritis and chronic pain.

Binding to NGF

The binding of Frunevetmab Biosimilar to NGF occurs through its variable regions, which recognize and bind to specific sites on the NGF protein. This binding is highly specific, as the antibody is designed to only bind to NGF and not other proteins in the body.

Inhibition of NGF activity

Once bound to NGF, Frunevetmab Biosimilar prevents the protein from binding to its receptors, TrkA and p75NTR. This inhibition of NGF activity leads to a decrease in the transmission of pain signals and a reduction in inflammation.

Applications of Frunevetmab Biosimilar

Frunevetmab Biosimilar is currently being studied for its potential therapeutic applications in various conditions, including osteoarthritis, chronic pain, and cancer.

Osteoarthritis

In osteoarthritis, the cartilage in the joints breaks down, leading to pain and inflammation. NGF has been shown to play a role in the development of osteoarthritis by promoting the growth of nerve fibers in the joints. By inhibiting NGF activity, Frunevetmab Biosimilar may be able to reduce pain and inflammation in patients with osteoarthritis.

Chronic pain

Chronic pain is a complex condition that can be caused by various factors, including nerve damage and inflammation. NGF has been implicated in the development and maintenance of chronic pain by promoting the growth of nerve fibers and sensitizing pain receptors. By blocking NGF activity, Frunevetmab Biosimilar may provide relief for patients suffering from chronic pain.

Cancer

NGF has also been shown to play a role in the growth and progression of certain types of cancer. By inhibiting NGF activity, Frunevetmab Biosimilar may have potential as a cancer therapy by preventing the growth and spread of cancer cells.

Conclusion

Frunevetmab Biosimilar is a promising biosimilar to the therapeutic antibody, Frunevetmab, with a similar structure and mechanism of action. By targeting and inhibiting NGF activity, it has the potential to provide relief for patients suffering from conditions such as osteoarthritis, chronic pain, and cancer. Further research and clinical trials are needed to fully understand the potential of Frunevetmab Biosimilar as a therapeutic option.

SDS-PAGE for Frunevetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade

SDS-PAGE for Frunevetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade

Frunevetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Frunevetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade

There are no reviews yet.

Be the first to review “Frunevetmab Biosimilar – Anti-NGF, NGFB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products