Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fontolizumab Biosimilar – Anti-IFNG mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Fontolizumab Biosimilar - Anti-IFNG mAb - Research Grade

Product name Fontolizumab Biosimilar - Anti-IFNG mAb - Research Grade
Uniprot ID P01579
Source CAS 326859-36-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Fontolizumab,HuZAF,IFNG,anti-IFNG
Reference PX-TA1043
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Fontolizumab Biosimilar - Anti-IFNG mAb - Research Grade
Uniprot ID P01579
Source CAS 326859-36-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Fontolizumab,HuZAF,IFNG,anti-IFNG
Reference PX-TA1043
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1043-50
Uniprot ID P01579
Source CAS 326859-36-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Fontolizumab,HuZAF,IFNG,anti-IFNG
Reference PX-TA1043
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction

Fontolizumab Biosimilar, also known as Anti-IFNG mAb, is a monoclonal antibody that targets the cytokine interferon-gamma (IFN-γ). This antibody has been developed as a potential therapeutic agent for various inflammatory and autoimmune diseases. In this article, we will discuss the structure, activity, and potential applications of Fontolizumab Biosimilar.

Structure of Fontolizumab Biosimilar

Fontolizumab Biosimilar is a chimeric monoclonal antibody, meaning it is composed of both human and non-human components. The antibody is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 25 kDa. The heavy and light chains are connected by disulfide bonds and form a Y-shaped structure.

The variable regions of the antibody, responsible for binding to IFN-γ, are derived from a mouse monoclonal antibody. The constant regions of the antibody, responsible for effector functions, are derived from a human antibody. This chimeric structure allows for specific binding to IFN-γ while also minimizing the potential for immune reactions.

Activity of Fontolizumab Biosimilar

Fontolizumab Biosimilar works by binding to IFN-γ and preventing it from binding to its receptor on target cells. This inhibits the downstream signaling pathways that lead to inflammation and autoimmune responses. Additionally, the binding of Fontolizumab Biosimilar to IFN-γ can also lead to the depletion of IFN-γ-producing cells, further reducing the levels of this cytokine in the body.

IFN-γ is a key player in the immune response, and its dysregulation has been linked to various diseases such as rheumatoid arthritis, Crohn’s disease, and psoriasis. By targeting IFN-γ, Fontolizumab Biosimilar has the potential to treat these diseases and provide relief to patients.

Applications of Fontolizumab Biosimilar

Fontolizumab Biosimilar is currently being studied as a potential treatment for various inflammatory and autoimmune diseases. Clinical trials have shown promising results in the treatment of rheumatoid arthritis, with improvements in symptoms and reduction in disease activity. Similarly, studies have also shown potential for Fontolizumab Biosimilar in the treatment of Crohn’s disease and psoriasis.

In addition to these conditions, Fontolizumab Biosimilar is also being investigated for its potential in treating other autoimmune diseases such as multiple sclerosis and lupus. The antibody’s ability to specifically target IFN-γ makes it a promising candidate for these diseases, which are characterized by dysregulated immune responses.

Conclusion

In summary, Fontolizumab Biosimilar is a chimeric monoclonal antibody that targets the cytokine IFN-γ. Its unique structure allows for specific binding to IFN-γ while minimizing the potential for immune reactions. This antibody has shown promising results in the treatment of various inflammatory and autoimmune diseases, making it a potential therapeutic option for patients in the future. Further research and clinical trials are needed to fully understand the potential of Fontolizumab Biosimilar and its role in the treatment of these diseases.

SDS-PAGE for Fontolizumab Biosimilar - Anti-IFNG;IFN-gamma mAb - Research Grade

SDS-PAGE for Fontolizumab Biosimilar - Anti-IFNG;IFN-gamma mAb - Research Grade

Fontolizumab Biosimilar - Anti-IFNG;IFN-gamma mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Fontolizumab Biosimilar - Anti-IFNG mAb - Research Grade

There are no reviews yet.

Be the first to review “Fontolizumab Biosimilar – Anti-IFNG mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products