Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Firastotug Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA1948-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Firastotug Biosimilar - Anti-CD152 mAb - Research Grade

Product name Firastotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2750031-14-0
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1948
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Firastotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2750031-14-0
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1948
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1948-50
Uniprot ID P16410
Source CAS: 2750031-14-0
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1948
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Firastotug Biosimilar is a research grade anti-CD152 monoclonal antibody (mAb) that has been developed for use in scientific research. This biosimilar is a highly specific and potent therapeutic tool that targets the CD152 protein, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4). In this article, we will explore the structure, activity, and potential applications of Firastotug Biosimilar in further detail.

Structure of Firastotug Biosimilar

Firastotug Biosimilar is a recombinant humanized IgG1 monoclonal antibody that has been produced using state-of-the-art genetic engineering techniques. It is composed of two heavy chains and two light chains, each of which contains a variable region and a constant region. The variable region of Firastotug Biosimilar is designed to specifically bind to the CD152 protein, while the constant region is responsible for mediating effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

The structure of Firastotug Biosimilar is highly similar to that of the original anti-CD152 mAb, making it a suitable alternative for use in research studies. The biosimilar has been extensively characterized to ensure its purity, stability, and potency, making it a reliable tool for scientific research.

Activity of Firastotug Biosimilar

Firastotug Biosimilar exerts its activity by binding to the CD152 protein, which is expressed on the surface of T cells and plays a critical role in regulating immune responses. By binding to CD152, Firastotug Biosimilar blocks the interaction between CD152 and its ligands, CD80 and CD86, thereby preventing the inhibitory signals that are normally transmitted by this pathway.

This inhibition of CD152 signaling leads to enhanced T cell activation and proliferation, which can have a variety of downstream effects. For example, Firastotug Biosimilar has been shown to enhance the production of pro-inflammatory cytokines such as interferon-gamma (IFN-γ) and interleukin-2 (IL-2), as well as the proliferation of effector T cells.

Potential Applications of Firastotug Biosimilar

Firastotug Biosimilar has a wide range of potential applications in scientific research, particularly in the fields of immunology and oncology. One of the key areas of interest for this biosimilar is in the study of autoimmune diseases, where it can be used to investigate the role of CD152 in regulating immune responses and potentially identify new therapeutic targets.

In addition, Firastotug Biosimilar has shown promise in the field of cancer immunotherapy. By blocking the inhibitory signals from CD152, this biosimilar can enhance the anti-tumor activity of T cells and potentially improve the efficacy of other cancer treatments.

Furthermore, Firastotug Biosimilar can also be used in the development and validation of diagnostic assays for CD152 expression, as well as in the screening of potential new drugs that target this protein.

Conclusion

Firastotug Biosimilar is a highly specific and potent research grade anti-CD152 monoclonal antibody that has been designed for use in scientific research. Its structure, activity, and potential applications make it a valuable tool for studying the role of CD152 in immune responses and identifying new therapeutic targets. With its proven purity, stability, and potency, Firastotug Biosimilar is a reliable choice for researchers looking to explore the complex mechanisms of the immune system.

SDS-PAGE for Research Grade Firastotug

SDS-PAGE for Research Grade Firastotug

Research Grade Firastotug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Firastotug binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Firastotug binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Firastotug in indirect ELISA with Goat secondary antibody measured by OD450.

Firastotug Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Firastotug Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products