Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Fibroblast growth factor 21(FGF21)(29-210)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9JJN1
Molecular weight:
21.15kDa

€182.00

50ug + 182 loyalty points
His Ala29–Ser210
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Fibroblast growth factor 21(FGF21)(29-210)

Fibroblast growth factor 21(FGF21)(29-210)

Product name Fibroblast Growth Factor proteins 21(FGF21)(29-210)
Uniprot ID Q9JJN1
Uniprot link https://www.uniprot.org/uniprot/Q9JJN1
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Molecular weight 21.15kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80%by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala29-Ser210
Protein Accession Q9JJN1
Spec:Entrez GeneID 56636
Spec:NCBI Gene Aliases Fgf8c
NCBI Reference Q9JJN1
Aliases /Synonyms FGF-21
Reference PX-P4735
Note For research use only
Molecular Constructor
His Ala29–Ser210
Product name Fibroblast Growth Factor proteins 21(FGF21)(29-210)
Uniprot ID Q9JJN1
Uniprot link https://www.uniprot.org/uniprot/Q9JJN1
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Molecular weight 21.15kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80%by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala29-Ser210
Protein Accession Q9JJN1
Spec:Entrez GeneID 56636
Spec:NCBI Gene Aliases Fgf8c
NCBI Reference Q9JJN1
Aliases /Synonyms FGF-21
Reference PX-P4735
Note For research use only
Molecular Constructor
His Ala29–Ser210

There are no reviews yet.

Be the first to review “Fibroblast growth factor 21(FGF21)(29-210)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products