Brand: ProteoGenix

Anti-Mouse FGF21 Polyclonal Antibody

PTX20285-50
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit
Isotype:: IgG

Original price was: €251.00.Current price is: €182.00.

50ug 27% OFF + 182 loyalty points

Size Size

50ug Original price was: €251.00.Current price is: €182.00.
100ug Original price was: €315.00.Current price is: €260.00.
1MG Original price was: €1,018.00.Current price is: €754.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Mouse FGF21 Polyclonal Antibody

Product name	PTX20285-100
Uniprot ID	Q9JJN1
Raw Antigen Sequence	AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-FGF21, Anti-FGF-21
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	FGF21
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Product name	PTX20285-1MG
Uniprot ID	Q9JJN1
Raw Antigen Sequence	AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-FGF21, Anti-FGF-21
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	FGF21
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Product name	PTX20285-50
Uniprot ID	Q9JJN1
Raw Antigen Sequence	AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-FGF21, Anti-FGF-21
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	FGF21
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000