Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Favezelimab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Favezelimab ELISA Kit

Favezelimab ELISA Kit

Product name Favezelimab ELISA Kit
Uniprot ID P18627
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX204
Note For research use only.
Sample type Plasma, Serum
Target Favezelimab
Immunogen Favezelimab

Introduction to Favezelimab ELISA Kit

Favezelimab ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) kit used for the detection and quantification of Favezelimab, a novel antibody therapeutic targeting a specific protein. This kit provides a reliable and efficient method for monitoring the levels of Favezelimab in various biological samples, making it a valuable tool for researchers and clinicians in the field of immunotherapy.

Structure of Favezelimab

Favezelimab is a monoclonal antibody that specifically binds to a protein known as CD20, which is expressed on the surface of B cells. It is a humanized IgG1 antibody, meaning that it is derived from human sequences but has been modified to reduce its immunogenicity. Favezelimab contains two heavy chains and two light chains, and its binding site is located in the variable region of the antibody.

Mechanism of Action

Favezelimab acts as a therapeutic antibody by binding to CD20 on the surface of B cells and inducing their death through a process known as antibody-dependent cellular cytotoxicity (ADCC). This mechanism of action is similar to other CD20-targeted antibodies, such as rituximab, but Favezelimab has been engineered to have a higher affinity for CD20, making it more potent and effective.

Application of Favezelimab ELISA Kit

The Favezelimab ELISA Kit is primarily used for monitoring the levels of Favezelimab in patient samples during clinical trials and after treatment with the antibody. This allows researchers and clinicians to assess the pharmacokinetics and pharmacodynamics of Favezelimab, as well as its efficacy and safety. The kit can also be used to measure the levels of Favezelimab in animal models, providing valuable insights into its in vivo behavior.

Clinical Trials

Favezelimab is currently being evaluated in clinical trials for the treatment of B-cell malignancies, including non-Hodgkin’s lymphoma and chronic lymphocytic leukemia. The Favezelimab ELISA Kit is an essential tool in these trials, as it allows researchers to accurately measure the levels of Favezelimab in patient samples and correlate them with clinical outcomes.

Pharmacokinetics and Pharmacodynamics

The Favezelimab ELISA Kit can also be used to study the pharmacokinetics and pharmacodynamics of Favezelimab. By measuring the levels of Favezelimab in different biological samples, such as serum or plasma, at different time points, researchers can determine the drug’s absorption, distribution, metabolism, and elimination. This information is crucial for optimizing dosing regimens and predicting potential drug interactions.

In vivo Studies

In addition to clinical trials, the Favezelimab ELISA Kit can be used in animal studies to assess the in vivo behavior of Favezelimab. By measuring the levels of Favezelimab in different tissues and organs, researchers can gain insights into its biodistribution and tissue penetration. This information is vital for understanding the drug’s mechanism of action and optimizing its therapeutic potential.

Conclusion

In summary, the Favezelimab ELISA Kit is a highly valuable tool for researchers and clinicians working with Favezelimab. It provides a sensitive and specific method for detecting and quantifying the levels of Favezelimab in various biological samples, making it an essential component of clinical trials and in vivo studies. With its high affinity and potent mechanism of action, Favezelimab has the potential to be a promising new therapy for B-cell malignancies, and the Favezelimab ELISA Kit plays a crucial role in its development and evaluation.

Favezelimab ELISA Kit

There are no reviews yet.

Be the first to review “Favezelimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products