Brand: ProteoGenix

Etanercept Biosimilar – Anti-TNF mAb – Research Grade

PX-TA1015-100UG
Validated ELISA

Clonality:: Monoclonal Antibody
Isotype:: IgG1-Fc

€200.00

100ug + 200 loyalty points

Size Size

50ug Original price was: €174.00.Current price is: €140.00.
100ug €200.00
1MG €800.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Etanercept Biosimilar - Anti-TNF mAb binds to TNFa / TNF-alpha, N-His, recombinant protein in indirect ELISA Assay

SDS-PAGE for Etanercept Biosimilar - Anti-TNF mAb - Research Grade

Datasheet

Etanercept Biosimilar - Anti-TNF mAb - Research Grade

Product name	Etanercept Biosimilar - Anti-TNF mAb - Research Grade
Uniprot ID	P01375
Source	DrugBank DB00005
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight	51kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Etanercept,Etanercept,TNF,anti-TNF
Reference	PX-TA1015
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	hG1-Fc
Clonality	Monoclonal Antibody

Product name	Etanercept Biosimilar - Anti-TNF mAb - Research Grade
Uniprot ID	P01375
Source	DrugBank DB00005
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight	51kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Etanercept,Etanercept,TNF,anti-TNF
Reference	PX-TA1015
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	hG1-Fc
Clonality	Monoclonal Antibody

Product name	PX-TA1015-50
Uniprot ID	P01375
Source	DrugBank DB00005
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight	51kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Etanercept,Etanercept,TNF,anti-TNF
Reference	PX-TA1015
Note	For research use only. Not suitable for human use.
Isotype	IgG1-Fc
Clonality	Monoclonal Antibody

General information about Etanercept

Etanercept is a biopharmaceutical that treats autoimmune diseases by interfering with tumor necrosis factor (TNF, a soluble inflammatory cytokine) by acting as a TNF inhibitor. It has U.S. F.D.A. approval to treat rheumatoid arthritis, juvenile idiopathic arthritis and psoriatic arthritis, plaque psoriasis and ankylosing spondylitis. TNF-alpha is the “master regulator” of the inflammatory (immune) response in many organ systems. Autoimmune diseases are caused by an overactive immune response. Etanercept has the potential to treat these diseases by inhibiting TNF-alpha. Etanercept is a fusion protein produced by recombinant DNA. It fuses the TNF receptor to the constant end of the IgG1 antibody. First, the developers isolated the DNA sequence that codes the human gene for soluble TNF receptor 2, which is a receptor that binds to tumor necrosis factor-alpha. Second, they isolated the DNA sequence that codes the human gene for the Fc end of immunoglobulin G1 (IgG1). Third, they linked the DNA for TNF receptor 2 to the DNA for IgG1 Fc. Finally, they expressed the linked DNA to produce a protein that links the protein for TNF receptor 2 to the protein for IgG1 Fc. It is a large molecule, with a molecular weight of 150 kDa, that binds to TNF alpha and decreases its role in disorders involving excess inflammation in humans and other animals, including autoimmune diseases such as ankylosing spondylitis, juvenile rheumatoid arthritis, psoriasis, psoriatic arthritis, rheumatoid arthritis, and, potentially, in a variety of other disorders mediated by excess TNFalpha. This product is for research use only.

Datasheet

Etanercept Biosimilar - Anti-TNF mAb binds to TNFa / TNF-alpha, N-His, recombinant protein in indirect ELISA Assay

Immobilized TNFa / TNF-alpha, N-His, recombinant protein (cat. No.PX-P5961) at 0.5µg/mL (100µL/well) can bind to Etanercept Biosimilar - Anti-TNF mAb (cat. No.PX-TA1015) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SDS-PAGE for Etanercept Biosimilar - Anti-TNF mAb - Research Grade

Etanercept Biosimilar - Anti-TNF mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.