Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Etakafusp Biosimilar – Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
P01732

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Etakafusp Biosimilar - Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein - Research Grade

Product name PX-TA2228-50
Uniprot ID P01732
Source CAS: 2852680-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A
Reference PX-TA2228-100
Note For research use only. Not suitable for human use.
Isotype Humanized Ig G1-kappa anti-(human CD8) fused at the C-terminus of one heavy chain, via peptide linker to a variant of human IL2
Product name Etakafusp Biosimilar - Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein - Research Grade
Uniprot ID P01732
Source CAS: 2852680-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A
Reference PX-TA2228-100
Note For research use only. Not suitable for human use.
Isotype Humanized Ig G1-kappa anti-(human CD8) fused at the C-terminus of one heavy chain, via peptide linker to a variant of human IL2
Product name Etakafusp Biosimilar - Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein - Research Grade
Uniprot ID P01732
Source CAS: 2852680-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A
Reference PX-TA2228-100
Note For research use only. Not suitable for human use.
Isotype Humanized Ig G1-kappa anti-(human CD8) fused at the C-terminus of one heavy chain, via peptide linker to a variant of human IL2

Introduction
Etakafusp Biosimilar is a therapeutic protein that has shown promising results in treating various types of cancer. It is a fusion protein that combines the anti-tumor activity of a T-cell surface glycoprotein CD8 alpha chain with the specificity of a monoclonal antibody. In this article, we will explore the structure, activity, and potential applications of Etakafusp Biosimilar as a research-grade therapeutic protein.

Structure of Etakafusp Biosimilar
Etakafusp Biosimilar is a fusion protein consisting of two main components: the T-cell surface glycoprotein CD8 alpha chain and a monoclonal antibody. The CD8 alpha chain is a protein found on the surface of T-cells, which are a type of immune cell responsible for fighting against cancer cells. The monoclonal antibody component of Etakafusp Biosimilar is designed to specifically target and bind to a protein called EpCAM, which is overexpressed in many types of cancer cells.

Activity of Etakafusp Biosimilar
The fusion of the CD8 alpha chain and the monoclonal antibody in Etakafusp Biosimilar results in a dual mechanism of action. The CD8 alpha chain component activates T-cells, enhancing their ability to recognize and kill cancer cells. This is achieved by binding to MHC class I molecules on the surface of cancer cells, which triggers the activation of T-cells. The monoclonal antibody component, on the other hand, specifically targets and binds to EpCAM on cancer cells, leading to their destruction through various mechanisms such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Applications of Etakafusp Biosimilar
Etakafusp Biosimilar has shown promising results in preclinical and clinical studies as a potential treatment for various types of cancer. One of the key advantages of this therapeutic protein is its ability to target and kill cancer cells while sparing healthy cells, thereby reducing the risk of side effects. It has shown efficacy in treating solid tumors such as lung, breast, and colon cancers, as well as hematological malignancies like leukemia and lymphoma.

Etakafusp Biosimilar has also shown potential as a research tool for studying the role of EpCAM in cancer development and progression. By targeting EpCAM, researchers can gain a better understanding of its function and its impact on cancer cells. This can lead to the development of new therapeutic strategies and the identification of potential biomarkers for early cancer detection.

Conclusion
Etakafusp Biosimilar is a promising research-grade therapeutic protein with a unique dual mechanism of action. Its fusion of the CD8 alpha chain and a monoclonal antibody allows for targeted and efficient destruction of cancer cells, making it a potential treatment option for various types of cancer. Its structure, activity, and potential applications make it a valuable tool for both research and clinical use in the fight against cancer.

SDS-PAGE for Etakafusp Alfa Biosimilar - Research Grade

SDS-PAGE for Etakafusp Alfa Biosimilar - Research Grade

Etakafusp Alfa Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Etakafusp Biosimilar – Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products