Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Redalsomatropin Biosimilar – Anti-GH-N fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
P01241 & P02768

Original price was: €244.00.Current price is: €200.00.

100ug 18% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Redalsomatropin Biosimilar - Anti-GH-N fusion protein - Research Grade

Product name PX-TA2234-50
Uniprot ID P01241 & P02768
Source CAS: 2793441-31-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GH-N, Pituitary growth hormone, GH1, Growth hormone, Growth hormone 1, GH, Somatotropin, ALB, Albumin
Reference PX-TA2234-100
Note For research use only. Not suitable for human use.
Isotype Human somatotropin (growth hormone (GH)) fused to human serum albumin fragment.
Product name Redalsomatropin Biosimilar - Anti-GH-N fusion protein - Research Grade
Uniprot ID P01241 & P02768
Source CAS: 2793441-31-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GH-N, Pituitary growth hormone, GH1, Growth hormone, Growth hormone 1, GH, Somatotropin, ALB, Albumin
Reference PX-TA2234-100
Note For research use only. Not suitable for human use.
Isotype Human somatotropin (growth hormone (GH)) fused to human serum albumin fragment.
Product name Redalsomatropin Biosimilar - Anti-GH-N fusion protein - Research Grade
Uniprot ID P01241 & P02768
Source CAS: 2793441-31-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GH-N, Pituitary growth hormone, GH1, Growth hormone, Growth hormone 1, GH, Somatotropin, ALB, Albumin
Reference PX-TA2234-100
Note For research use only. Not suitable for human use.
Isotype Human somatotropin (growth hormone (GH)) fused to human serum albumin fragment.

Title: Introduction to Redalsomatropin Biosimilar – A Revolutionary Therapeutic Protein

Redalsomatropin Biosimilar is a groundbreaking therapeutic protein that has been developed as a biosimilar version of the human growth hormone (GH). It is a fusion protein that combines the anti-GH activity with the natural activity of GH-N, making it a highly effective therapeutic agent. In this article, we will explore the structure, activity, and potential applications of Redalsomatropin Biosimilar in the field of medicine.

Title: Structure of Redalsomatropin Biosimilar

Redalsomatropin Biosimilar is a fusion protein composed of two distinct components – the anti-GH and GH-N. The anti-GH component is derived from a naturally occurring protein that has the ability to bind to the GH receptor and inhibit its activity. On the other hand, the GH-N component is a fragment of the human growth hormone that is responsible for its natural activity in the body. The two components are linked together using recombinant DNA technology to create a single, stable fusion protein.

Title: Activity of Redalsomatropin Biosimilar

Redalsomatropin Biosimilar exhibits a dual activity due to the presence of both anti-GH and GH-N components. The anti-GH component binds to the GH receptor and blocks its activity, thereby reducing the levels of GH in the body. This is particularly beneficial in conditions where excess GH is produced, such as acromegaly. The GH-N component, on the other hand, mimics the natural activity of GH and promotes growth and development in the body. This makes Redalsomatropin Biosimilar an ideal therapeutic protein for treating growth hormone deficiency and other related disorders.

Title: Therapeutic Target of Redalsomatropin Biosimilar

The therapeutic target of Redalsomatropin Biosimilar is the GH receptor, which is present on the surface of cells in various tissues and organs. By targeting this receptor, Redalsomatropin Biosimilar is able to exert its anti-GH and GH-N activity, making it a highly effective therapeutic agent for a range of conditions related to GH imbalance. The ability to target the GH receptor also makes Redalsomatropin Biosimilar a potential treatment for other conditions such as Turner syndrome, Prader-Willi syndrome, and short stature in children.

Title: Applications of Redalsomatropin Biosimilar

Redalsomatropin Biosimilar has a wide range of potential applications in the field of medicine. It can be used to treat conditions such as acromegaly, growth hormone deficiency, Turner syndrome, and Prader-Willi syndrome. In addition, it has shown promising results in treating short stature in children, especially those with idiopathic short stature. Redalsomatropin Biosimilar can also be used in combination with other therapeutic proteins for the treatment of various disorders. Furthermore, its research grade quality makes it an ideal tool for studying the role of GH in various physiological processes.

Title: Conclusion

In conclusion, Redalsomatropin Biosimilar is a revolutionary therapeutic protein that combines the anti-GH activity with the natural activity of GH-N. Its unique structure and dual activity make it a highly effective treatment option for a range of conditions related to GH imbalance. With its potential applications in various disorders and research grade quality, Redalsomatropin Biosimilar is set to make a significant impact in the field of medicine.

SDS-PAGE for Redalsomatropin Alfa Biosimilar - Research Grade

SDS-PAGE for Redalsomatropin Alfa Biosimilar - Research Grade

Redalsomatropin Alfa Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Redalsomatropin Biosimilar – Anti-GH-N fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products