Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efimosfermin Biosimilar – Anti-FGF21 fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
Q9NSA1

Original price was: €174.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Efimosfermin Biosimilar - Anti-FGF21 fusion protein - Research Grade

Product name PX-TA2226-50
Uniprot ID Q9NSA1
Source CAS: 2765640-39-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FGF21, Fibroblast growth factor 21, FGF-21
Reference PX-TA2226-100
Note For research use only. Not suitable for human use.
Isotype Fc fragment of human Ig G1 fused via peptide linker to human FGF-21 fragment-variant
Product name Efimosfermin Biosimilar - Anti-FGF21 fusion protein - Research Grade
Uniprot ID Q9NSA1
Source CAS: 2765640-39-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FGF21, Fibroblast growth factor 21, FGF-21
Reference PX-TA2226-100
Note For research use only. Not suitable for human use.
Isotype Fc fragment of human Ig G1 fused via peptide linker to human FGF-21 fragment-variant
Product name Efimosfermin Biosimilar - Anti-FGF21 fusion protein - Research Grade
Uniprot ID Q9NSA1
Source CAS: 2765640-39-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FGF21, Fibroblast growth factor 21, FGF-21
Reference PX-TA2226-100
Note For research use only. Not suitable for human use.
Isotype Fc fragment of human Ig G1 fused via peptide linker to human FGF-21 fragment-variant

Efimosfermin Biosimilar: A Revolutionary Therapeutic Protein Targeting FGF21

Efimosfermin Biosimilar is a novel therapeutic protein that has gained significant attention in the field of medical research due to its unique structure, potent activity, and promising applications. This fusion protein is designed to target and modulate the activity of fibroblast growth factor 21 (FGF21), a key regulator of metabolism and energy balance. In this article, we will delve deeper into the structure, activity, and potential applications of Efimosfermin Biosimilar as a research grade therapeutic protein.

Structure of Efimosfermin Biosimilar

Efimosfermin Biosimilar is a fusion protein composed of two distinct components: the Fc region of human immunoglobulin G1 (IgG1) and the extracellular domain of FGF21. The Fc region serves as the backbone of the protein, providing stability and facilitating its binding to FGF21 receptors. On the other hand, the extracellular domain of FGF21 is responsible for the therapeutic activity of Efimosfermin Biosimilar.

The Fc region of IgG1 is a well-characterized protein with a molecular weight of approximately 50 kDa. It consists of two heavy chains and two light chains, connected by disulfide bonds. The Fc region is responsible for the effector functions of IgG1, including antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). By incorporating the Fc region into Efimosfermin Biosimilar, the protein gains enhanced stability and a longer half-life in the body, making it an ideal candidate for therapeutic use.

The extracellular domain of FGF21 is a 21 kDa protein that plays a crucial role in regulating metabolism and energy balance. It is composed of 181 amino acids and contains a β-trefoil structure, which is essential for its binding to FGF21 receptors. The extracellular domain of FGF21 is responsible for the therapeutic activity of Efimosfermin Biosimilar, making it a potent and specific modulator of FGF21 signaling.

Activity of Efimosfermin Biosimilar

The primary mode of action of Efimosfermin Biosimilar is through its binding to FGF21 receptors. FGF21 receptors are transmembrane proteins that belong to the fibroblast growth factor receptor (FGFR) family. These receptors are expressed in various tissues, including the liver, adipose tissue, and pancreas, and play a crucial role in regulating metabolism and energy balance.

Upon binding to FGF21 receptors, Efimosfermin Biosimilar activates downstream signaling pathways, leading to the modulation of key metabolic processes. These include increasing insulin sensitivity, promoting fat burning, and reducing glucose production in the liver. By targeting FGF21 receptors, Efimosfermin Biosimilar offers a unique approach to treating metabolic disorders such as obesity, type 2 diabetes, and non-alcoholic fatty liver disease.

Potential Applications of Efimosfermin Biosimilar

Efimosfermin Biosimilar has shown promising results in preclinical studies, making it a potential candidate for various therapeutic applications. One of the key areas where Efimosfermin Biosimilar could have a significant impact is in the treatment of type 2 diabetes. By improving insulin sensitivity and reducing glucose production, Efimosfermin Biosimilar could help regulate blood sugar levels and improve glycemic control in diabetic patients.

Another potential application of Efimosfermin Biosimilar is in the treatment of obesity. By promoting fat burning and reducing appetite, Efimosfermin Biosimilar could aid in weight loss and improve metabolic health in obese individuals. It could also have a role in treating non-alcoholic fatty liver disease, a condition closely linked to obesity and insulin resistance.

Furthermore, Efimosfermin Biosimilar could also have potential applications in other metabolic disorders, such as dyslipidemia and metabolic syndrome. By modulating

There are no reviews yet.

Be the first to review “Efimosfermin Biosimilar – Anti-FGF21 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products