Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Antiviral protein DAP-30

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P24476 (99,2%)
Molecular weight:
29.84kDa

€329.00

100ug + 329 loyalty points
Ala24–Lys277
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Antiviral protein DAP-30

Antiviral protein DAP-30

Product name Antiviral protein DAP-30
Uniprot ID P24476 (99,2%)
Uniprot link https://www.uniprot.org/uniprot/P24476 (99,2%)
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGATAYTLNLANPSASQYSSFLDQIRNNVRDTSLIYGGTDVAVIGAPSTTDKFLRLNFQGPRGTVSLGLRR ENLYVVAYLAMDNANVNRAYYFKNQITSAELTALFPEVVVANQKQLEYGEDYQAIEKNAKITTGDQSRKELGLGINLLIT MIDGVNKKVRVVKDEARFLLIAIQMTAEAARFRYIQNLVTKNFPNKFDSENKVIQFQVSWSKISTAIFGDAKNGVFNKDY DFGFGKVRQAKDLQMGLLKYLGRPKAC
Molecular weight 29.84kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala24-Lys277
Aliases /Synonyms Dianthin 30,Ribosome-inactivating protein,rRNA N-glycosidase
Reference PX-P4372
Note For research use only
Molecular Constructor
Ala24–Lys277
Product name Antiviral protein DAP-30
Uniprot ID P24476 (99,2%)
Uniprot link https://www.uniprot.org/uniprot/P24476 (99,2%)
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGATAYTLNLANPSASQYSSFLDQIRNNVRDTSLIYGGTDVAVIGAPSTTDKFLRLNFQGPRGTVSLGLRR ENLYVVAYLAMDNANVNRAYYFKNQITSAELTALFPEVVVANQKQLEYGEDYQAIEKNAKITTGDQSRKELGLGINLLIT MIDGVNKKVRVVKDEARFLLIAIQMTAEAARFRYIQNLVTKNFPNKFDSENKVIQFQVSWSKISTAIFGDAKNGVFNKDY DFGFGKVRQAKDLQMGLLKYLGRPKAC
Molecular weight 29.84kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala24-Lys277
Aliases /Synonyms Dianthin 30,Ribosome-inactivating protein,rRNA N-glycosidase
Reference PX-P4372
Note For research use only
Molecular Constructor
Ala24–Lys277

There are no reviews yet.

Be the first to review “Antiviral protein DAP-30”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products