Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

TNFRSF12A recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9NP84
Molecular weight:
30.72 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Glu28–Trp79 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

TNFRSF12A recombinant protein

Product name PX-P5208-100
Uniprot ID Q9NP84
Uniprot link https://www.uniprot.org/uniprot/Q9NP84
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW
Molecular weight 30.72 kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu28-Trp79
Protein Accession Q9NP84
Aliases /Synonyms FN14, TWEAKR
Reference PX-P5208
Note For research use only
Molecular Constructor
Glu28–Trp79 Fc
Product name PX-P5208-1MG
Uniprot ID Q9NP84
Uniprot link https://www.uniprot.org/uniprot/Q9NP84
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW
Molecular weight 30.72 kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu28-Trp79
Protein Accession Q9NP84
Aliases /Synonyms FN14, TWEAKR
Reference PX-P5208
Note For research use only
Molecular Constructor
Glu28–Trp79 Fc
Product name PX-P5208-50
Uniprot ID Q9NP84
Uniprot link https://www.uniprot.org/uniprot/Q9NP84
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW
Molecular weight 30.72 kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu28-Trp79
Protein Accession Q9NP84
Aliases /Synonyms FN14, TWEAKR
Reference PX-P5208
Note For research use only
Molecular Constructor
Glu28–Trp79 Fc

TNFRSF12A recombinant protein

There are no reviews yet.

Be the first to review “TNFRSF12A recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products