Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Albipagrastim Biosimilar – Anti-C17orf33 fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
P09919 & P02768

Original price was: €260.00.Current price is: €200.00.

100ug 23% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Albipagrastim Biosimilar - Anti-C17orf33 fusion protein - Research Grade

Product name PX-TA2222-50
Uniprot ID P09919 & P02768
Source CAS: 2817686-50-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF, ALB, Albumin
Reference PX-TA2222-100
Note For research use only. Not suitable for human use.
Isotype Human Serum Albumin fragment 25-609 fused to Human Granulocyte Colony stimulating Factor fragment 27-200-variant
Product name Albipagrastim Biosimilar - Anti-C17orf33 fusion protein - Research Grade
Uniprot ID P09919 & P02768
Source CAS: 2817686-50-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF, ALB, Albumin
Reference PX-TA2222-100
Note For research use only. Not suitable for human use.
Isotype Human Serum Albumin fragment 25-609 fused to Human Granulocyte Colony stimulating Factor fragment 27-200-variant
Product name Albipagrastim Biosimilar - Anti-C17orf33 fusion protein - Research Grade
Uniprot ID P09919 & P02768
Source CAS: 2817686-50-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF, ALB, Albumin
Reference PX-TA2222-100
Note For research use only. Not suitable for human use.
Isotype Human Serum Albumin fragment 25-609 fused to Human Granulocyte Colony stimulating Factor fragment 27-200-variant

Introduction

Albipagrastim Biosimilar is a therapeutic protein that has recently gained attention in the field of biotechnology. It is an Anti-C17orf33 fusion protein, which has been developed as a biosimilar of the existing therapeutic protein, Filgrastim. In this article, we will discuss the structure, activity, and application of Albipagrastim Biosimilar in detail.

Structure of Albipagrastim Biosimilar

Albipagrastim Biosimilar is a fusion protein that is composed of two components – Anti-C17orf33 and Filgrastim. The Anti-C17orf33 is a monoclonal antibody that specifically binds to the C17orf33 protein, which is a therapeutic target for various diseases. On the other hand, Filgrastim is a recombinant human granulocyte colony-stimulating factor (G-CSF) that is commonly used as a therapeutic protein to stimulate the production of white blood cells in patients with compromised immune systems.

The fusion of these two components results in a protein with a molecular weight of approximately 40 kDa. The Anti-C17orf33 component is attached to the N-terminal of Filgrastim, while the C-terminal of Filgrastim remains intact. This unique structure of Albipagrastim Biosimilar allows it to target the C17orf33 protein while also retaining the activity of Filgrastim.

Activity of Albipagrastim Biosimilar

The main activity of Albipagrastim Biosimilar is to stimulate the production of white blood cells, specifically neutrophils. This is achieved through the action of Filgrastim, which binds to the G-CSF receptor on the surface of bone marrow cells. This binding activates a signaling pathway that leads to the proliferation and differentiation of neutrophils, resulting in an increase in their numbers in the bloodstream.

In addition to its activity on white blood cells, Albipagrastim Biosimilar also has an anti-inflammatory effect. This is due to the action of the Anti-C17orf33 component, which blocks the activity of the C17orf33 protein. This protein is known to play a role in inflammation and its inhibition can lead to a reduction in inflammation.

Therapeutic Applications of Albipagrastim Biosimilar

Due to its unique structure and activity, Albipagrastim Biosimilar has a wide range of therapeutic applications. It is primarily used for the treatment of neutropenia, a condition characterized by a low level of neutrophils in the blood. Neutropenia can be caused by various factors such as chemotherapy, radiation therapy, and certain diseases. By stimulating the production of neutrophils, Albipagrastim Biosimilar helps to prevent infections and improve the overall health of patients with neutropenia.

Moreover, Albipagrastim Biosimilar has shown promising results in the treatment of autoimmune disorders such as rheumatoid arthritis and multiple sclerosis. The anti-inflammatory effect of the Anti-C17orf33 component can help to reduce the symptoms of these diseases and improve the quality of life for patients.

Conclusion

In conclusion, Albipagrastim Biosimilar is a therapeutic protein that has a unique structure and activity. It is composed of two components – Anti-C17orf33 and Filgrastim – which work together to stimulate the production of white blood cells and reduce inflammation. This biosimilar has a wide range of therapeutic applications, including the treatment of neutropenia and autoimmune disorders. With further research and development, Albipagrastim Biosimilar has the potential to become a valuable therapeutic option for various diseases.

There are no reviews yet.

Be the first to review “Albipagrastim Biosimilar – Anti-C17orf33 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products