Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ecleralimab Biosimilar – Anti-TSLP mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Fab-G1-lambda2

Original price was: €192.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade

Product name Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2415207-91-7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ecleralimab,CSJ 117, CSJ-117, NVP-CSJ117,TSLP,anti-TSLP
Reference PX-TA1783
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-lambda2
Clonality Monoclonal Antibody
Product name Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2415207-91-7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ecleralimab,CSJ 117, CSJ-117, NVP-CSJ117,TSLP,anti-TSLP
Reference PX-TA1783
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-lambda2
Clonality Monoclonal Antibody
Product name PX-TA1783-50
Uniprot ID Q969D9
Source CAS: 2415207-91-7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ecleralimab,CSJ 117, CSJ-117, NVP-CSJ117,TSLP,anti-TSLP
Reference PX-TA1783
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-lambda2
Clonality Monoclonal Antibody

Introduction

Ecleralimab Biosimilar, also known as Anti-TSLP mAb, is a monoclonal antibody that specifically targets the protein thymic stromal lymphopoietin (TSLP). This protein is known to play a key role in the development and progression of various inflammatory diseases, making it a promising therapeutic target.

Structure of Ecleralimab Biosimilar

Ecleralimab Biosimilar is a fully humanized monoclonal antibody, meaning it is derived from human cells and has a high affinity for its target. It is composed of two identical heavy chains and two identical light chains, which are connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and is produced using recombinant DNA technology.

Mechanism of Action

Ecleralimab Biosimilar works by binding to TSLP and preventing it from interacting with its receptor, thereby inhibiting the downstream signaling pathways that lead to inflammation. TSLP is known to activate various immune cells, such as T cells, dendritic cells, and mast cells, which play a crucial role in the development of inflammatory diseases. By blocking this interaction, Ecleralimab Biosimilar helps to reduce the production of pro-inflammatory cytokines and chemokines, ultimately leading to a decrease in inflammation.

Applications of Ecleralimab Biosimilar

Ecleralimab Biosimilar is currently being studied for its potential use in various inflammatory diseases, including asthma, atopic dermatitis, and chronic obstructive pulmonary disease (COPD). These diseases are characterized by chronic inflammation, which can lead to tissue damage and impaired function of affected organs. By targeting TSLP, Ecleralimab Biosimilar has the potential to provide a novel treatment option for these conditions.

Asthma

Asthma is a chronic respiratory disease that affects millions of people worldwide. It is characterized by airway inflammation, which leads to symptoms such as wheezing, shortness of breath, and coughing. TSLP has been shown to play a crucial role in the development of asthma, making it a promising therapeutic target for Ecleralimab Biosimilar. Clinical trials are currently underway to evaluate the safety and efficacy of this antibody in patients with asthma.

Atopic Dermatitis

Atopic dermatitis, also known as eczema, is a chronic inflammatory skin disease that affects a large number of people globally. It is characterized by itchy, red, and inflamed skin. TSLP has been found to be overexpressed in the skin of patients with atopic dermatitis, and its levels correlate with disease severity. By targeting TSLP, Ecleralimab Biosimilar has the potential to provide a targeted and effective treatment for this condition.

Chronic Obstructive Pulmonary Disease (COPD)

COPD is a progressive lung disease that is characterized by chronic inflammation and obstruction of airflow. TSLP has been shown to play a role in the development of COPD, and its levels are elevated in the lungs of patients with this condition. Ecleralimab Biosimilar has the potential to reduce inflammation and improve lung function in patients with COPD, making it a promising therapeutic option.

Research Grade Ecleralimab Biosimilar

In addition to its potential as a therapeutic agent, Ecleralimab Biosimilar is also available in a research grade form for use in laboratory studies. This allows researchers to further investigate the role of TSLP in various diseases and evaluate the efficacy of this antibody in preclinical models.

Conclusion

Ecleralimab Biosimilar, also known as Anti-TSLP mAb, is a promising monoclonal antibody that targets the protein TSLP. By inhibiting the activity

SDS-PAGE for Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade

SDS-PAGE for Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade

Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade

There are no reviews yet.

Be the first to review “Ecleralimab Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products