Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

DnaJ homolog subfamily C member 5B(Dnajc5b)

Host species:
Escherichia coli (E.coli)
Origin species:
House Mouse
Uniprot ID:
Q9CQ94

210.00

50ug + 210 loyalty points
Met1–Ser199
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

DnaJ homolog subfamily C member 5B(Dnajc5b)

Product name DnaJ homolog subfamily C member 5B(Dnajc5b)
Uniprot ID Q9CQ94
Uniprot link https://www.uniprot.org/uniprot/Q9CQ94
Origin species House Mouse
Expression system Prokaryotic expression
Sequence MGMACNAPNQRQRTLSTSGESLYEILGLHKGASCEEIKKTYRKLALRHHPDKNPDDPSAAEKFKEINNAHTILTDTSKRNIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKTLFIIIGLLTGCYFCCCLCCCCNCCCGHCRPKSSTPEEEFYVSPEDLEEQIRTDMEKDMDFPVVLQPTNTNEKTQLIREGSRSYCTDSLEHHHHHH
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser199
Aliases /Synonyms Cysteine string protein beta,CSP-beta
Reference PX-P4808
Note For research use only
Molecular Constructor
Met1–Ser199
Product name DnaJ homolog subfamily C member 5B(Dnajc5b)
Uniprot ID Q9CQ94
Uniprot link https://www.uniprot.org/uniprot/Q9CQ94
Origin species House Mouse
Expression system Prokaryotic expression
Sequence MGMACNAPNQRQRTLSTSGESLYEILGLHKGASCEEIKKTYRKLALRHHPDKNPDDPSAAEKFKEINNAHTILTDTSKRNIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKTLFIIIGLLTGCYFCCCLCCCCNCCCGHCRPKSSTPEEEFYVSPEDLEEQIRTDMEKDMDFPVVLQPTNTNEKTQLIREGSRSYCTDSLEHHHHHH
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser199
Aliases /Synonyms Cysteine string protein beta,CSP-beta
Reference PX-P4808
Note For research use only
Molecular Constructor
Met1–Ser199

There are no reviews yet.

Be the first to review “DnaJ homolog subfamily C member 5B(Dnajc5b)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products