Name: Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein
SKU: PX-P3018-10
Availability: InStock

Size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Insect
Applications	Elisa, WB

Product name	Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein
Uniprot ID	A1YW12
Uniprot link	http://www.uniprot.org/uniprot/A1YW12
Origin species	Dermatophagoides farinae (American house dust mite)
Expression system	Eukaryotic expression
Sequence	MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQKLVDCASQHGCHGDTIPRGIE YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLM MIEQYPYVVIMGSHHHHHH
Molecular weight	51.58 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Applications	ELISA,WB
Fragment Type	Full-length
NCBI Reference	A1YW12
Aliases /Synonyms	Der f 1 allergen(Derf1)
Reference	PX-P3018
Note	For research use only

No Products found