Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

  • PX-TA1912-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CM101 Biosimilar - Anti-MPIF2 mAb - Research Grade

Product name CM101 Biosimilar - Anti-MPIF2 mAb - Research Grade
Uniprot ID O00175
Source CM-101, CM101
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-MPIF2,Eosinophil chemotactic protein 2,Small-inducible cytokine A24,CCL24,Eotaxin-2,SCYA24,MPIF-2,Myeloid progenitor inhibitory factor 2,CK-beta-6,C-C motif chemokine 24,CM-101, CM101
Reference PX-TA1912
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody
Product name CM101 Biosimilar - Anti-MPIF2 mAb - Research Grade
Uniprot ID O00175
Source CM-101, CM101
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-MPIF2,Eosinophil chemotactic protein 2,Small-inducible cytokine A24,CCL24,Eotaxin-2,SCYA24,MPIF-2,Myeloid progenitor inhibitory factor 2,CK-beta-6,C-C motif chemokine 24,CM-101, CM101
Reference PX-TA1912
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody
Product name PX-TA1912-50
Uniprot ID O00175
Source CM-101, CM101
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-MPIF2,Eosinophil chemotactic protein 2,Small-inducible cytokine A24,CCL24,Eotaxin-2,SCYA24,MPIF-2,Myeloid progenitor inhibitory factor 2,CK-beta-6,C-C motif chemokine 24,CM-101, CM101
Reference PX-TA1912
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody

Introduction to CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade is a novel monoclonal antibody (mAb) that has been developed as a biosimilar to the original CM101 antibody. This biosimilar is specifically designed to target the therapeutic protein MPIF2, which plays a crucial role in inflammation and immune response. In this article, we will discuss the structure, activity, and potential applications of CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade.

Structure of CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade is a recombinant humanized IgG1/k monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of the antibody is responsible for binding to its target, MPIF2, while the constant region is responsible for effector functions such as complement activation and antibody-dependent cellular cytotoxicity (ADCC).

Activity of CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

The primary function of CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade is to target and neutralize the activity of MPIF2. MPIF2 is a chemokine that is involved in the recruitment and activation of immune cells in response to inflammation. By binding to MPIF2, this biosimilar prevents its interaction with its receptors, thereby reducing the recruitment and activation of immune cells. This leads to a decrease in inflammation and an overall improvement in the immune response.

Application of CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade has potential applications in various inflammatory and autoimmune diseases. Its ability to target and neutralize the activity of MPIF2 makes it a promising therapeutic option for conditions such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. It can also be used in combination with other therapies to enhance their efficacy.

Advantages of CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

One of the major advantages of CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade is its biosimilarity to the original CM101 antibody. This means that it has a highly similar structure, activity, and efficacy as the original antibody, making it a reliable and safe treatment option. Additionally, its humanized structure reduces the risk of immunogenicity, making it suitable for long-term use.

Title: Clinical Trials and Results of CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade Several clinical trials have been conducted to evaluate the safety and efficacy of CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade. In a phase 1 trial, the biosimilar was found to be well-tolerated with no serious adverse events reported. In a phase 2 trial, it showed promising results in reducing disease activity in patients with rheumatoid arthritis. Further trials are ongoing to explore its potential in other inflammatory and autoimmune diseases.

Conclusion

In conclusion, CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade is a novel biosimilar that has been developed to target the therapeutic protein MPIF2. Its structure, activity, and potential applications make it a promising therapeutic option for various inflammatory and autoimmune diseases. With ongoing clinical trials and promising results, this biosimilar has the potential to improve the lives of patients suffering from these conditions.

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade in ELISA Assay

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade in ELISA Assay

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade in WB Assay

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade in WB Assay

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

CM101 Biosimilar - Anti-MPIF2 mAb - Research Grade

There are no reviews yet.

Be the first to review “CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products