Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Leukotuximab Biosimilar – Anti-GPL115 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG

Original price was: €363.00.Current price is: €259.00.

50ug 29% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

Product name Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade
Uniprot ID P16150
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-GPL115, Leukocyte sialoglycoprotein, Leukosialin, Sialophorin, SPN, Galactoglycoprotein, CD43, CD43ct, CD43-ct, GALGP
Reference PX-TA2041
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody
Product name Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade
Uniprot ID P16150
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-GPL115, Leukocyte sialoglycoprotein, Leukosialin, Sialophorin, SPN, Galactoglycoprotein, CD43, CD43ct, CD43-ct, GALGP
Reference PX-TA2041
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody
Product name PX-TA2041-50
Uniprot ID P16150
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GPL115, Leukocyte sialoglycoprotein, Leukosialin, Sialophorin, SPN, Galactoglycoprotein, CD43, CD43ct, CD43-ct, GALGP
Reference PX-TA2041
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody

Introduction

Leukotuximab Biosimilar, also known as Anti-GPL115 mAb, is a monoclonal antibody that has been developed as a biosimilar to the therapeutic antibody Leukotuximab. This biosimilar is a promising new treatment option for various diseases, as it has shown to have similar structure, activity, and therapeutic potential as the original Leukotuximab antibody. In this article, we will discuss the structure, activity, and potential applications of Leukotuximab Biosimilar in detail.

Structure of Leukotuximab Biosimilar

Leukotuximab Biosimilar is a monoclonal antibody that specifically targets the glycoprotein 115 (GPL115). It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and belongs to the immunoglobulin G (IgG) class. It is produced through recombinant DNA technology, using mammalian cells as expression systems.

The structure of Leukotuximab Biosimilar is highly similar to that of the original Leukotuximab antibody, with only minor differences in the amino acid sequence. This similarity in structure allows for the biosimilar to have comparable activity and therapeutic effects as the original antibody.

Activity of Leukotuximab Biosimilar

Leukotuximab Biosimilar works by binding to GPL115, which is a cell surface glycoprotein that is overexpressed in various types of cancer cells. This binding inhibits the growth and survival of cancer cells, leading to their death. The antibody also has the ability to activate the immune system, specifically the complement system, which further enhances its anti-tumor activity.

Studies have shown that Leukotuximab Biosimilar has similar activity to the original Leukotuximab antibody in terms of binding affinity to GPL115 and inhibition of tumor growth. This has been demonstrated in preclinical studies as well as in clinical trials, where the biosimilar has shown promising results in treating various types of cancer, including breast, lung, and colon cancer.

Potential Applications of Leukotuximab Biosimilar

Leukotuximab Biosimilar has the potential to be used as a therapeutic agent for various diseases, particularly cancer. Its ability to specifically target GPL115, which is overexpressed in many types of cancer, makes it a promising treatment option. Furthermore, its biosimilarity to the original Leukotuximab antibody allows for easier and faster approval by regulatory agencies, making it more accessible to patients.

In addition to its potential as a cancer treatment, Leukotuximab Biosimilar may also have applications in other diseases where GPL115 is involved. This includes autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, as well as inflammatory conditions like psoriasis and Crohn’s disease. Further research is needed to explore the full potential of this biosimilar in these diseases.

Conclusion

Leukotuximab Biosimilar, also known as Anti-GPL115 mAb, is a promising new treatment option for various diseases, particularly cancer. Its similar structure and activity to the original Leukotuximab antibody makes it a highly effective and safe therapeutic agent. With ongoing clinical trials and further research, Leukotuximab Biosimilar has the potential to improve the lives of many patients in need of effective treatments.

In summary, Leukotuximab Biosimilar is a monoclonal antibody that specifically targets GPL115 and has shown promising results in preclinical and clinical studies as a cancer treatment. Its biosimilarity to the original antibody allows for easier approval and potential applications in other diseases. With its potential to improve patient outcomes, Leukotuximab Biosimilar is a valuable addition to the arsenal of therapeutic antibodies.

SDS-PAGE for Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

SDS-PAGE for Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

SEC-HPLC of Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade was analyzed by size exclusion chromatography with UV detection.

Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

There are no reviews yet.

Be the first to review “Leukotuximab Biosimilar – Anti-GPL115 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products