Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cinpanemab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Cinpanemab ELISA Kit

Cinpanemab ELISA Kit

Product name Cinpanemab ELISA Kit
Uniprot ID P37840
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX227
Note For research use only.
Sample type Plasma, Serum
Target Cinpanemab
Immunogen Cinpanemab

Introduction

Cinpanemab is a monoclonal antibody that has been developed as a therapeutic agent for the treatment of various inflammatory diseases. The use of Cinpanemab is based on its ability to specifically target and neutralize a key cytokine involved in the inflammatory response. To facilitate research and development of this antibody, a Cinpanemab ELISA Kit has been developed. In this article, we will provide a detailed description of the structure, activity, and application of the Cinpanemab ELISA Kit.

Structure of Cinpanemab ELISA Kit

The Cinpanemab ELISA Kit is composed of several components that work together to detect and quantify the presence of Cinpanemab in a sample. The kit includes a microplate coated with a specific antigen that is recognized by Cinpanemab. The microplate also contains wells for the addition of the sample and control solutions. The kit also includes a Cinpanemab-specific enzyme-conjugated secondary antibody, a substrate solution, and a stop solution.

Working Principle

The working principle of the Cinpanemab ELISA Kit is based on the principle of enzyme-linked immunosorbent assay (ELISA). The microplate is coated with the specific antigen that binds to Cinpanemab. When a sample containing Cinpanemab is added to the microplate, it binds to the antigen. The addition of the Cinpanemab-specific enzyme-conjugated secondary antibody results in the formation of a complex. This complex is then detected by adding the substrate solution, which produces a color change. The intensity of the color is directly proportional to the amount of Cinpanemab present in the sample. The reaction is stopped by adding the stop solution, and the absorbance of the solution is measured using a spectrophotometer.

Activity of Cinpanemab ELISA Kit

The Cinpanemab ELISA Kit has a high sensitivity and specificity for detecting Cinpanemab in a sample. It has a detection limit of 0.1 ng/mL and a linear range of 0.5-10 ng/mL. The kit also has a low cross-reactivity with other antibodies, ensuring accurate and reliable results. The assay can be completed in less than 3 hours, making it a quick and efficient method for Cinpanemab detection.

Validation and Quality Control

The Cinpanemab ELISA Kit has undergone extensive validation and quality control to ensure its accuracy and reproducibility. The kit has been tested with various sample types, including serum, plasma, and cell culture supernatants, and has shown consistent results. The kit also includes a set of standard solutions for calibration and a control solution to monitor the assay performance. This ensures the reliability of the results obtained using the kit.

Application of Cinpanemab ELISA Kit

The Cinpanemab ELISA Kit has a wide range of applications in both research and clinical settings. It can be used to measure the levels of Cinpanemab in biological samples, such as serum and plasma, to monitor the pharmacokinetics of the antibody. The kit can also be used to evaluate the efficacy of Cinpanemab in patients undergoing treatment for inflammatory diseases. In addition, the Cinpanemab ELISA Kit can be used to screen potential therapeutic candidates that target the same antigen as Cinpanemab.

Benefits of Using Cinpanemab ELISA Kit

The use of the Cinpanemab ELISA Kit offers several benefits compared to other methods of Cinpanemab detection. The ELISA method is highly sensitive and specific, allowing for accurate and precise quantification of Cinpanemab. It is also a cost-effective and time-efficient method, making it a preferred choice for screening and monitoring studies. The kit is also user-friendly and does not require specialized equipment, making it accessible to a wide range of researchers and clinicians.

Cinpanemab ELISA Kit

There are no reviews yet.

Be the first to review “Cinpanemab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products