Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD70 antigen (CD70)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P32970

210.00

50ug + 210 loyalty points
His Gln39–Pro193
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD70 antigen (CD70)

Product name CD70 antigen (CD70)
Uniprot ID P32970
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gln39-Pro193
Aliases /Synonyms CD27 ligand,CD27-L,Tumor necrosis factor ligand superfamily member 7,CD70,CD27L, CD27LG, TNFSF7
Reference PX-P4642
Note For research use only
Molecular Constructor
His Gln39–Pro193
Product name CD70 antigen (CD70)
Uniprot ID P32970
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gln39-Pro193
Aliases /Synonyms CD27 ligand,CD27-L,Tumor necrosis factor ligand superfamily member 7,CD70,CD27L, CD27LG, TNFSF7
Reference PX-P4642
Note For research use only
Molecular Constructor
His Gln39–Pro193

CD70 antigen (CD70)

There are no reviews yet.

Be the first to review “CD70 antigen (CD70)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products