Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD276 Recombinant Protein |
|---|---|
| Uniprot ID | Q5ZPR3 |
| Uniprot link | http://www.uniprot.org/uniprot/Q5ZPR3 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT |
| Molecular weight | 70kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Thr461 |
| Aliases /Synonyms | B7H3, PSEC0249, UNQ309/PRO352 |
| Reference | PX-P4125 |
| Note | For research use only |
CD276, also known as B7-H3, is a member of the B superfamily and has IgV and IgG regions in the extracellular domain. It is a type I transmembrane protein with 20-27% amino acid identity to other members of the B7 family. B7-H3 participates in the activation of T lymphocytes and regulates the formation of mouse bone. It has also been reported that B7-H3 may play an important role in muscle-immune interaction, providing further evidence for the active role of muscle cells in the local immune regulation process. B7-H3 is expressed on T cells, natural lethal cells and antigenic cells, and certain non-immune cells (such as osteoblasts, fibroblasts, fibroblast-like synovial cells, and epithelial cells). The high expression of B7-H3 in the tumor vasculature also indicates poor patient survival, indicating that it may play a role in the migration of tumor cells.
Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind to Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb (cat. No.PX-TA1410) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.