Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD274 / PD-L1 / B7-H1, N-His, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9NZQ7
Molecular weight:
27.50 kDa

329.00

100ug + 329 loyalty points
His Phe19–Arg238
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD274 / PD-L1 / B7-H1, N-His, recombinant protein

Product name CD274 / PD-L1 / B7-H1, N-His, recombinant protein
Uniprot ID Q9NZQ7
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Molecular weight 27.50 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe19-Arg238
Protein Accession Q9NZQ7
Reference PX-P5608
Note For research use only
Molecular Constructor
His Phe19–Arg238

General information on CD274 / PD-L1 / B7-H1, N-His, recombinant protein

Structure

CD274 / PD-L1 / B7-H1 is a type I transmembrane protein that is expressed on the surface of various cells, including antigen-presenting cells. It is composed of a single extracellular immunoglobulin-like domain, a transmembrane domain, and a short cytoplasmic tail.

Activity

CD274 / PD-L1 / B7-H1 is an inhibitory receptor that binds to its ligand, programmed cell death-1 (PD-1), expressed on the surface of activated T cells. This interaction suppresses T cell activation and proliferation, and promotes the induction of tolerance.

Application

CD274 / PD-L1 / B7-H1 is involved in the regulation of immune responses and is a target for immunotherapy. The use of monoclonal antibodies to block the interaction between CD274 / PD-L1 / B7-H1 and PD-1 has been shown to enhance anti-tumor immunity, leading to improved clinical outcomes in cancer patients.

SDS-PAGE for CD274 / PD-L1 / B7-H1, N-His, recombinant protein

SDS-PAGE for CD274 / PD-L1 / B7-H1, N-His, recombinant protein

CD274 / PD-L1 / B7-H1, N-His, recombinant protein on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is superior than 90 %

CD274 / PD-L1 / B7-H1, N-His, recombinant protein

There are no reviews yet.

Be the first to review “CD274 / PD-L1 / B7-H1, N-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products