Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bremzalerbart Biosimilar – Anti-BETVIA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €175.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Product name Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2046
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2046
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA2046-50
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2046
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction to Bremzalerbart Biosimilar – Anti-BETVIA mAb

Bremzalerbart Biosimilar – Anti-BETVIA mAb is a novel therapeutic antibody that has been developed as a biosimilar to target the protein BETVIA. This biosimilar is a research grade antibody that has shown promising results in pre-clinical studies and is expected to have potential therapeutic applications in the treatment of various diseases. In this article, we will discuss the structure, activity, and potential applications of Bremzalerbart Biosimilar – Anti-BETVIA mAb in detail.

Structure of Bremzalerbart Biosimilar – Anti-BETVIA mAb

Bremzalerbart Biosimilar – Anti-BETVIA mAb is a monoclonal antibody (mAb) that is produced through recombinant DNA technology. It is a fully humanized antibody, meaning that it is derived from human genes and has a high affinity for the target protein BETVIA. The antibody has a typical mAb structure, with two heavy chains and two light chains joined by disulfide bonds. The heavy chains consist of variable and constant regions, while the light chains consist of only variable regions. The variable regions of the antibody are responsible for binding to the target protein, while the constant regions determine the effector functions of the antibody.

Activity of Bremzalerbart Biosimilar – Anti-BETVIA mAb

Bremzalerbart Biosimilar – Anti-BETVIA mAb specifically targets the protein BETVIA, which is a key regulator of various cellular processes. BETVIA is known to play a crucial role in the development and progression of several diseases, including cancer, autoimmune disorders, and inflammatory diseases. Bremzalerbart Biosimilar – Anti-BETVIA mAb binds to BETVIA with high affinity, thereby blocking its activity and inhibiting its downstream signaling pathways. This leads to the suppression of disease-promoting processes and ultimately results in therapeutic benefits.

Title: Potential Applications of Bremzalerbart Biosimilar – Anti-BETVIA mAb

Bremzalerbart Biosimilar – Anti-BETVIA mAb has shown promising results in pre-clinical studies for the treatment of various diseases. Its ability to specifically target BETVIA makes it a potential therapeutic option for diseases where BETVIA plays a critical role. Some of the potential applications of Bremzalerbart Biosimilar – Anti-BETVIA mAb are:

1.

Cancer: BETVIA is known to be involved in the development and progression of various types of cancer. Bremzalerbart Biosimilar – Anti-BETVIA mAb has shown promising results in inhibiting the growth and spread of cancer cells in pre-clinical studies. It is expected to have potential applications in the treatment of different types of cancer, including breast cancer, lung cancer, and leukemia.

2.

Autoimmune disorders: BETVIA is also implicated in the pathogenesis of autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis. Bremzalerbart Biosimilar – Anti-BETVIA mAb has shown potential in pre-clinical studies for the treatment of these disorders by suppressing the overactive immune response.

3. Inflammatory diseases: BETVIA is known to play a role in promoting inflammation in various diseases, including asthma, psoriasis, and inflammatory bowel disease. Bremzalerbart Biosimilar – Anti-BETVIA mAb has shown promising results in reducing inflammation and symptoms associated with these diseases.

Conclusion

Bremzalerbart Biosimilar – Anti-BETVIA mAb is a novel therapeutic antibody that specifically targets the protein BETVIA. Its unique structure and high affinity for BETVIA make it a promising therapeutic option for various diseases, including cancer, autoimmune disorders, and inflammatory diseases. Further clinical studies are needed to determine the full potential of this biosimilar in the treatment of these diseases.

SDS-PAGE for Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade

SDS-PAGE for Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade

There are no reviews yet.

Be the first to review “Bremzalerbart Biosimilar – Anti-BETVIA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products