Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

beta-nerve growth factor(NGF)

  • PX-P4646-1MG
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Dog
Uniprot ID:
A0A3Q7RVL5
Molecular weight:
51.9kDa

Original price was: €1,571.00.Current price is: €1,218.00.

1MG 22% OFF + 1218 loyalty points
Met1–Gly238 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

beta-nerve growth factor(NGF)

Product name PX-P4646-1MG
Uniprot ID A0A3Q7RVL5
Uniprot link https://www.uniprot.org/uniprot/A0A3Q7RVL5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MSMLFYTLITALLIGIRAEPHPESHVPAGHAIPHAHWTKLQHSLDTALRRARSAPAGAIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADAQDLDLEAGSTASVNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPTPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAG
Molecular weight 51.9kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly238
Protein Accession XP_025850472
Spec:NCBI Gene Aliases NGF
NCBI Reference XP_025850472
Reference PX-P4646
Note For research use only.
Molecular Constructor
Met1–Gly238 Fc
Product name beta-nerve Growth Factor proteins(NGF)
Uniprot ID A0A3Q7RVL5
Uniprot link https://www.uniprot.org/uniprot/A0A3Q7RVL5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MSMLFYTLITALLIGIRAEPHPESHVPAGHAIPHAHWTKLQHSLDTALRRARSAPAGAIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADAQDLDLEAGSTASVNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPTPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAG
Molecular weight 51.9kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly238
Protein Accession XP_025850472
Spec:NCBI Gene Aliases NGF
NCBI Reference XP_025850472
Reference PX-P4646
Note For research use only
Molecular Constructor
Met1–Gly238 Fc
Product name beta-nerve Growth Factor proteins(NGF)
Uniprot ID A0A3Q7RVL5
Uniprot link https://www.uniprot.org/uniprot/A0A3Q7RVL5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MSMLFYTLITALLIGIRAEPHPESHVPAGHAIPHAHWTKLQHSLDTALRRARSAPAGAIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADAQDLDLEAGSTASVNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPTPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAG
Molecular weight 51.9kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly238
Protein Accession XP_025850472
Spec:NCBI Gene Aliases NGF
NCBI Reference XP_025850472
Reference PX-P4646
Note For research use only
Molecular Constructor
Met1–Gly238 Fc

Beta-nerve growth factor(NGF) binds to Tanezumab Biosimilar - Anti-IGHE mAb in indirect ELISA assay

Beta-nerve growth factor(NGF) binds to Tanezumab Biosimilar - Anti-IGHE mAb in indirect ELISA assay

Immobilized beta-nerve growth factor(NGF) (cat. No.PX-P4646) at 0.5µg/mL (100µL/well) can bind Tanezumab Biosimilar - Anti-IGHE mAb (cat. No.PX-TA1164) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 229.8M.

SDS-PAGE for beta-nerve growth factor(NGF)

SDS-PAGE for beta-nerve growth factor(NGF)

beta-nerve growth factor(NGF), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

beta-nerve growth factor(NGF)

There are no reviews yet.

Be the first to review “beta-nerve growth factor(NGF)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products