Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tanezumab Biosimilar – Anti-IGHE mAb – Research Grade

  • PX-TA1164-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tanezumab Biosimilar - Anti-IGHE mAb - Research Grade

Product name Tanezumab Biosimilar - Anti-IGHE mAb - Research Grade
Uniprot ID P01138
Source CAS 880266-57-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tanezumab,PF-04383119,RN624,IGHE,anti-IGHE
Reference PX-TA1164
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Tanezumab Biosimilar - Anti-IGHE mAb - Research Grade
Uniprot ID P01138
Source CAS 880266-57-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tanezumab,PF-04383119,RN624,IGHE,anti-IGHE
Reference PX-TA1164
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1164-50
Uniprot ID P01138
Source CAS 880266-57-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tanezumab,PF-04383119,RN624,IGHE,anti-IGHE
Reference PX-TA1164
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

The Structure of Tanezumab Biosimilar – Anti-IGHE mAb

Tanezumab Biosimilar, also known as Anti-IGHE mAb, is a monoclonal antibody (mAb) designed to target and neutralize the activity of Immunoglobulin E (IgE). It is a biosimilar version of the original Tanezumab drug, which was developed by Pfizer and is currently in clinical trials for the treatment of chronic pain.

The structure of Tanezumab Biosimilar is similar to that of the original Tanezumab drug, with a few modifications to ensure its efficacy and safety as a biosimilar. It is composed of two heavy chains and two light chains, linked together by disulfide bonds. The heavy chains are made up of around 450 amino acids, while the light chains consist of around 220 amino acids.

The variable regions of Tanezumab Biosimilar, which are responsible for binding to IgE, are located at the tips of the heavy and light chains. These regions are highly specific and complementary to the IgE molecule, allowing Tanezumab Biosimilar to bind to and neutralize IgE with high affinity.

The Activity of Tanezumab Biosimilar

The main activity of Tanezumab Biosimilar is its ability to bind to IgE and prevent it from binding to its receptors on immune cells. IgE is an important mediator of allergic reactions and inflammation, and by blocking its activity, Tanezumab Biosimilar can help alleviate symptoms associated with these conditions.

In addition to its anti-IgE activity, Tanezumab Biosimilar also has anti-inflammatory effects. It has been shown to inhibit the release of inflammatory mediators from immune cells, which can contribute to the development of chronic pain. This dual mechanism of action makes Tanezumab Biosimilar a promising therapeutic agent for the treatment of chronic pain and other inflammatory conditions.

The Application of Tanezumab Biosimilar

Tanezumab Biosimilar is currently being studied as a potential treatment for chronic pain, specifically in patients with osteoarthritis, chronic low back pain, and cancer pain. These conditions are often associated with inflammation and increased levels of IgE, making Tanezumab Biosimilar a suitable therapeutic target.

In preclinical studies, Tanezumab Biosimilar has shown promising results in reducing pain and improving physical function in animal models of chronic pain. It has also been well-tolerated and has not shown any significant side effects. These findings have led to the initiation of clinical trials to evaluate the safety and efficacy of Tanezumab Biosimilar in humans.

As a biosimilar, Tanezumab Biosimilar offers a more affordable alternative to the original Tanezumab drug, making it accessible to a larger population of patients. It also has the potential to improve patient outcomes and quality of life, as chronic pain can significantly impact daily activities and overall well-being.

Conclusion

Tanezumab Biosimilar, also known as Anti-IGHE mAb, is a monoclonal antibody designed to neutralize the activity of IgE. Its structure is similar to the original Tanezumab drug, with modifications to ensure its efficacy and safety as a biosimilar. Tanezumab Biosimilar has anti-IgE and anti-inflammatory activity, making it a promising therapeutic target for chronic pain and other inflammatory conditions. It is currently being studied in clinical trials and has the potential to improve patient outcomes and quality of life as a more affordable treatment option.

Beta-nerve growth factor(NGF) binds to Tanezumab Biosimilar - Anti-IGHE mAb in indirect ELISA assay

Beta-nerve growth factor(NGF) binds to Tanezumab Biosimilar - Anti-IGHE mAb in indirect ELISA assay

Immobilized beta-nerve growth factor(NGF) (cat. No.PX-P4646) at 0.5µg/mL (100µL/well) can bind Tanezumab Biosimilar - Anti-IGHE mAb (cat. No.PX-TA1164) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 229.8M.

Tanezumab Biosimilar - Anti-IGHE mAb - Research Grade

There are no reviews yet.

Be the first to review “Tanezumab Biosimilar – Anti-IGHE mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products