Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Befovacimab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Befovacimab ELISA Kit

Befovacimab ELISA Kit

Product name Befovacimab ELISA Kit
Uniprot ID P10646
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX170
Note For research use only.
Sample type Plasma, Serum
Target Befovacimab
Immunogen Befovacimab

Introduction

Befovacimab is a monoclonal antibody that has been developed as a therapeutic agent for the treatment of various diseases. It specifically targets a protein called vascular endothelial growth factor (VEGF), which plays a critical role in the formation of new blood vessels. Befovacimab works by binding to VEGF and preventing it from interacting with its receptors, thereby inhibiting the growth of new blood vessels. This mechanism of action makes Befovacimab a promising therapeutic target for a variety of diseases, including cancer, age-related macular degeneration, and diabetic retinopathy.

Structure of Befovacimab

Befovacimab is a monoclonal antibody, which means it is a laboratory-produced protein that is designed to mimic the natural antibodies produced by the human immune system. It is a large molecule consisting of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains contain four constant regions and one variable region, while the light chains contain two constant regions and one variable region. These variable regions are responsible for the specificity of Befovacimab, as they bind to the target protein VEGF.

Activity of Befovacimab

Befovacimab is a potent inhibitor of VEGF, which is a key regulator of new blood vessel formation. In normal physiological conditions, VEGF promotes the growth of new blood vessels to supply oxygen and nutrients to tissues. However, in certain diseases such as cancer, VEGF is overexpressed, leading to excessive blood vessel growth and contributing to disease progression. Befovacimab works by binding to VEGF and preventing it from binding to its receptors on the surface of endothelial cells, which are the cells that line the inner walls of blood vessels. This prevents the activation of downstream signaling pathways that promote blood vessel growth, ultimately inhibiting the formation of new blood vessels.

Application of Befovacimab ELISA Kit

The Befovacimab ELISA (enzyme-linked immunosorbent assay) Kit is a diagnostic tool used for the quantitative measurement of Befovacimab levels in biological samples. It is a highly sensitive and specific assay that utilizes the principle of antigen-antibody binding to detect and quantify Befovacimab in a sample. The ELISA kit consists of a microplate coated with a specific anti-Befovacimab antibody, which captures the Befovacimab present in the sample. After washing away any unbound components, a secondary antibody labeled with an enzyme is added, which binds to the captured Befovacimab. Subsequent addition of a substrate for the enzyme results in the production of a colored product, the intensity of which is directly proportional to the amount of Befovacimab present in the sample. The color intensity is then measured using a spectrophotometer, and the Befovacimab concentration can be determined by comparing it to a standard curve.

The Befovacimab ELISA Kit has a wide range of applications in the field of drug development and clinical research. It can be used to measure Befovacimab levels in patient samples to monitor treatment response and assess drug efficacy. It can also be used to determine the pharmacokinetics of Befovacimab, such as its absorption, distribution, metabolism, and excretion in the body. Additionally, the Befovacimab ELISA Kit can be used to screen potential drug candidates for their ability to bind to Befovacimab, providing valuable information for drug development.

Conclusion

Befovacimab is a monoclonal antibody that specifically targets VEGF, a protein involved in the formation of new blood vessels. It works by binding to VEGF and preventing it from binding to its receptors, inhibiting the growth of new blood vessels. The Befovacimab ELISA Kit is a valuable tool for the quantitative measurement of Befovacimab levels in biological samples, with a wide range of applications in drug development and clinical research.

Befovacimab ELISA Kit

There are no reviews yet.

Be the first to review “Befovacimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products