Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12)

Original price was: €359.00.Current price is: €274.00.

50ug 24% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12)

Product name ARO-A15628-100
Uniprot ID P01831
Raw Antigen Sequence MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15628
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Thy-1.2/CD90.2
Clone Name 30-H12
Protein Name Thy-1.2/CD90.2
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15628-1MG
Uniprot ID P01831
Raw Antigen Sequence MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15628
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Thy-1.2/CD90.2
Clone Name 30-H12
Protein Name Thy-1.2/CD90.2
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15628-50
Uniprot ID P01831
Raw Antigen Sequence MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15628
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Thy-1.2/CD90.2
Clone Name 30-H12
Protein Name Thy-1.2/CD90.2
Target species Anti-Mouse Monoclonal Antibody

SDS-PAGE for Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12)

SDS-PAGE for Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12)

Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12)

There are no reviews yet.

Be the first to review “Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products