Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12), PerCP

Clonality:
Monoclonal Antibody
Host species:
Rat
Isotype:
IgG2b, kappa
Target species:
Mouse
Clone Name:
30-H12

Original price was: €164.00.Current price is: €132.00.

50ug 20% OFF + 132 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12), PerCP

Product name ARO-A10112-100
Uniprot ID P01831
Raw Antigen Sequence MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rat
Aliases /Synonyms Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A10112
Note For research use only.
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Target THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name 30-H12
Target species Mouse
Product name ARO-A10112-1MG
Uniprot ID P01831
Raw Antigen Sequence MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rat
Aliases /Synonyms Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A10112
Note For research use only.
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Target THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name 30-H12
Target species Mouse
Product name ARO-A10112-50
Uniprot ID P01831
Raw Antigen Sequence MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rat
Aliases /Synonyms Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A10112
Note For research use only.
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Target THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name 30-H12
Target species Mouse

There are no reviews yet.

Be the first to review “Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12), PerCP”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products