Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)

  • ARO-A15643-50
  • Validated WB

Original price was: €332.00.Current price is: €274.00.

50ug 17% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)

Product name ARO-A15643-100
Uniprot ID Q64253
Raw Antigen Sequence MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse
Reference ARO-A15643
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen LY6E/SCA-2
Clone Name 9B12.v12
Protein Name LY6E/SCA-2
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15643-1MG
Uniprot ID Q64253
Raw Antigen Sequence MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse
Reference ARO-A15643
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen LY6E/SCA-2
Clone Name 9B12.v12
Protein Name LY6E/SCA-2
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15643-50
Uniprot ID Q64253
Raw Antigen Sequence MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse
Reference ARO-A15643
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen LY6E/SCA-2
Clone Name 9B12.v12
Protein Name LY6E/SCA-2
Target species Anti-Human, Mouse Monoclonal Antibody

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12) binds to Mouse LY6E recombinant protein in WB Assay

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12) binds to Mouse LY6E recombinant protein in WB Assay

Mouse LY6E recombinant protein(cat. No.PX-P6501) can bind Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12) in Western Blot Assay as detected on gel analysis.

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)

There are no reviews yet.

Be the first to review “Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products