Brand: ProteoGenix

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)

ARO-A15643-50
Validated WB

Original price was: €332.00.Current price is: €274.00.

50ug 17% OFF + 274 loyalty points

Size Size

50ug Original price was: €332.00.Current price is: €274.00.
100ug Original price was: €516.00.Current price is: €391.00.
1MG Original price was: €1,440.00.Current price is: €1,134.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12) binds to Mouse LY6E recombinant protein in WB Assay

Datasheet

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)

Product name	ARO-A15643-100
Uniprot ID	Q64253
Raw Antigen Sequence	MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human, Mouse
Reference	ARO-A15643
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	LY6E/SCA-2
Clone Name	9B12.v12
Protein Name	LY6E/SCA-2
Target species	Anti-Human, Mouse Monoclonal Antibody

Product name	ARO-A15643-1MG
Uniprot ID	Q64253
Raw Antigen Sequence	MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human, Mouse
Reference	ARO-A15643
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	LY6E/SCA-2
Clone Name	9B12.v12
Protein Name	LY6E/SCA-2
Target species	Anti-Human, Mouse Monoclonal Antibody

Product name	ARO-A15643-50
Uniprot ID	Q64253
Raw Antigen Sequence	MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human, Mouse
Reference	ARO-A15643
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	LY6E/SCA-2
Clone Name	9B12.v12
Protein Name	LY6E/SCA-2
Target species	Anti-Human, Mouse Monoclonal Antibody

Datasheet

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12) binds to Mouse LY6E recombinant protein in WB Assay

Mouse LY6E recombinant protein(cat. No.PX-P6501) can bind Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12) in Western Blot Assay as detected on gel analysis.