Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human TNFSF15/TL1A Antibody (320-587)

Original price was: €354.00.Current price is: €272.00.

50ug 23% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human TNFSF15/TL1A Antibody (320-587)

Product name ARO-A15640-100
Uniprot ID O95150
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reference ARO-A15640
Isotype IgG2a, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TNFSF15
Clone Name 320-587
Protein Name TNFSF15
Target species Anti- Monoclonal Antibody
Product name ARO-A15640-1MG
Uniprot ID O95150
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reference ARO-A15640
Isotype IgG2a, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TNFSF15
Clone Name 320-587
Protein Name TNFSF15
Target species Anti- Monoclonal Antibody
Product name ARO-A15640-50
Uniprot ID O95150
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reference ARO-A15640
Isotype IgG2a, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TNFSF15
Clone Name 320-587
Protein Name TNFSF15
Target species Anti- Monoclonal Antibody

SDS-PAGE for Anti-Human TNFSF15/TL1A Antibody (320-587)

SDS-PAGE for Anti-Human TNFSF15/TL1A  Antibody (320-587)

Anti-Human TNFSF15/TL1A Antibody (320-587), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human TNFSF15/TL1A  Antibody (320-587)

There are no reviews yet.

Be the first to review “Anti-Human TNFSF15/TL1A Antibody (320-587)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products