Brand: ProteoGenix

Anti-Human TNFa/TNF-alpha Antibody (SAA0415)

ARO-A15524-50
Validated FC

Original price was: €311.00.Current price is: €239.00.

50ug 23% OFF + 239 loyalty points

Size Size

50ug Original price was: €311.00.Current price is: €239.00.
100ug Original price was: €445.00.Current price is: €342.00.
1MG Original price was: €1,379.00.Current price is: €992.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Flow Cytometry results for Anti-Human TNFa/TNF-alpha Antibody (SAA0415)

Datasheet

Anti-Human TNFa/TNF-alpha Antibody (SAA0415)

Product name	ARO-A15524-100
Uniprot ID	P01375
Raw Antigen Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15524
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	TNFa/TNF-alpha
Clone Name	SAA0415
Protein Name	TNFa/TNF-alpha
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15524-1MG
Uniprot ID	P01375
Raw Antigen Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15524
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	TNFa/TNF-alpha
Clone Name	SAA0415
Protein Name	TNFa/TNF-alpha
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15524-50
Uniprot ID	P01375
Raw Antigen Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15524
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	TNFa/TNF-alpha
Clone Name	SAA0415
Protein Name	TNFa/TNF-alpha
Target species	Anti-Human Monoclonal Antibody

Datasheet

Flow Cytometry results for Anti-Human TNFa/TNF-alpha Antibody (SAA0415)

Target Cells were stained with an irrelevant antibody or Anti-Human TNFa/TNF-alpha Antibody (SAA0415) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.