Brand: ProteoGenix

Anti-Human TNFa/TNF-alpha Antibody (SAA0415), APC

ARO-A10428-50
Validated FC

Clonality:: Monoclonal Antibody
Host species:: Mouse
Isotype:: IgG2a, kappa
Target species:: Human
Clone Name:: SAA0415

Original price was: €435.00.Current price is: €311.00.

50ug 29% OFF + 311 loyalty points

Size Size

50ug Original price was: €435.00.Current price is: €311.00.
100ug Original price was: €617.00.Current price is: €444.00.
1MG Original price was: €1,597.00.Current price is: €1,288.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human TNFa/TNF-alpha Antibody (SAA0415), APC

Product name	ARO-A10428-100
Uniprot ID	P01375
Raw Antigen Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference	ARO-A10428
Note	For research use only.
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Target	TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Clone Name	SAA0415
Target species	Human

Product name	ARO-A10428-1MG
Uniprot ID	P01375
Raw Antigen Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference	ARO-A10428
Note	For research use only.
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Target	TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Clone Name	SAA0415
Target species	Human

Product name	ARO-A10428-50
Uniprot ID	P01375
Raw Antigen Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference	ARO-A10428
Note	For research use only.
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Target	TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Clone Name	SAA0415
Target species	Human

Datasheet

Flow Cytometry results for Anti-Human TNFa/TNF-alpha Antibody (SAA0415), APC

Flow-cytometry using APC anti-human TNFa antibody. 293T transfected cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human TNFa monoclonal antibody (Catalog ARO-A10428, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human TNFa/TNF-alpha Antibody (SAA0415), APC”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *