Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE

  • ARO-A10693-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG2a, kappa
Target species:
Human
Clone Name:
SAA0415

Original price was: €426.00.Current price is: €311.00.

50ug 27% OFF + 311 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE

Product name ARO-A10693-100
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference ARO-A10693
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Clone Name SAA0415
Target species Human
Product name ARO-A10693-1MG
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference ARO-A10693
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Clone Name SAA0415
Target species Human
Product name ARO-A10693-50
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference ARO-A10693
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Clone Name SAA0415
Target species Human

Flow Cytometry results for Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE

Flow Cytometry results for Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE

Flow-cytometry using PE anti-human TNFa antibody. 293T transfected cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human TNFa monoclonal antibody (Catalog ARO-A10693, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products