Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human EPO Antibody (SAA0420)

Original price was: €311.00.Current price is: €239.00.

50ug 23% OFF + 239 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human EPO Antibody (SAA0420)

Product name ARO-A15539-100
Uniprot ID P01588
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15539
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen EPO
Clone Name SAA0420
Protein Name EPO
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15539-1MG
Uniprot ID P01588
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15539
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen EPO
Clone Name SAA0420
Protein Name EPO
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15539-50
Uniprot ID P01588
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15539
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen EPO
Clone Name SAA0420
Protein Name EPO
Target species Anti-Human Monoclonal Antibody

Introduction

Anti-Human EPO Antibody (SAA0420) is a monoclonal antibody that specifically targets and binds to human erythropoietin (EPO). EPO is a hormone that plays a crucial role in the production of red blood cells and is primarily produced by the kidneys. This antibody has been extensively studied and has shown promising results in both therapeutic and research settings. In this article, we will discuss the structure, activity, and potential applications of Anti-Human EPO Antibody.

Structure of Anti-Human EPO Antibody

Anti-Human EPO Antibody is a monoclonal antibody, meaning it is produced by a single type of immune cell and is identical in structure and function. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The antibody has a Y-shaped structure, with the two arms of the Y binding specifically to EPO.

Activity of Anti-Human EPO Antibody

The main activity of Anti-Human EPO Antibody is to bind to EPO and prevent it from interacting with its receptor. EPO is essential for the survival and maturation of red blood cells, and its binding to the EPO receptor triggers a signaling cascade that leads to the production of new red blood cells. By binding to EPO, Anti-Human EPO Antibody blocks this signaling pathway and prevents the production of new red blood cells.

Therapeutic Target

Anti-Human EPO Antibody has been identified as a potential therapeutic target for various conditions related to erythropoietin, such as anemia and polycythemia. Anemia is a condition characterized by a decrease in the number of red blood cells, and EPO is commonly used to treat anemia by stimulating the production of new red blood cells. However, in certain conditions, such as cancer and chronic kidney disease, EPO levels can become too high, leading to a condition known as polycythemia. In these cases, Anti-Human EPO Antibody can be used to block the effects of EPO and prevent the overproduction of red blood cells.

Research Use

In addition to its potential therapeutic applications, Anti-Human EPO Antibody is also widely used in research. It is commonly used in experiments to study the role of EPO in various biological processes and diseases. For example, researchers may use this antibody to block EPO signaling and observe the effects on red blood cell production or to study the effects of EPO on other cell types.

Potential Applications

Apart from its role as a therapeutic target and research tool, Anti-Human EPO Antibody has other potential applications. One such application is in doping control. EPO has been used as a performance-enhancing drug in sports, and Anti-Human EPO Antibody can be used to detect the presence of exogenous EPO in athletes’ blood samples.

Another potential application is in the treatment of autoimmune diseases. EPO has been shown to have anti-inflammatory effects, and Anti-Human EPO Antibody may be able to mimic these effects by blocking EPO signaling.

Conclusion

In summary, Anti-Human EPO Antibody (SAA0420) is a monoclonal antibody that specifically targets and binds to human erythropoietin. It has a Y-shaped structure and its main activity is to block EPO signaling. This antibody has potential therapeutic applications in conditions related to EPO and is also widely used in research. With its diverse applications, Anti-Human EPO Antibody is a valuable tool in the study and treatment of various diseases.

SDS-PAGE for Anti-Human EPO Antibody (SAA0420)

SDS-PAGE for Anti-Human EPO Antibody (SAA0420)

Anti-Human EPO Antibody (SAA0420), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human EPO Antibody (SAA0420)

There are no reviews yet.

Be the first to review “Anti-Human EPO Antibody (SAA0420)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products