Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human EPO/Erythropoietin ELISA Kit

Assay type:
Quantitative, Competitive

750.00

96T + 750 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human EPO/Erythropoietin ELISA Kit

Human EPO/Erythropoietin ELISA Kit

Product name Human EPO/Erythropoietin ELISA Kit
Uniprot ID P01588
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stocks, 3-5 weeks if production is needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Note For research use only.
Immunogen EPO
Assay type Quantitative, Competitive

The Structure and Function of Human EPO/Erythropoietin ELISA Kit

The Human EPO/Erythropoietin ELISA Kit is a powerful tool used in scientific research to detect and quantify the levels of Erythropoietin (EPO) in human samples. EPO is a hormone produced by the kidneys that plays a crucial role in the production of red blood cells. This ELISA kit is specifically designed to measure the levels of human EPO, making it a valuable tool for studying the regulation and function of this hormone.

Structure of the Human EPO/Erythropoietin ELISA Kit

The Human EPO/Erythropoietin ELISA Kit is composed of several components that work together to accurately measure the levels of EPO in a sample. The kit includes a microplate coated with a specific antibody that binds to EPO, a standard or control sample of known EPO concentration, and a series of reagents and solutions for sample preparation and detection. The microplate is divided into wells, each of which can hold a specific volume of sample or reagent.

The key component of the kit is the antibody, which is designed to specifically bind to EPO. This antibody is typically produced in animals such as rabbits or mice, and is carefully selected and validated to ensure high specificity and sensitivity. When a sample containing EPO is added to the microplate, the EPO molecules bind to the antibody, forming an EPO-antibody complex.

Activity of the Human EPO/Erythropoietin ELISA Kit

The activity of the Human EPO/Erythropoietin ELISA Kit is based on the principle of enzyme-linked immunosorbent assay (ELISA). This technique utilizes the binding of an antibody to its target molecule, in this case EPO, to detect and quantify the levels of the target molecule in a sample. The EPO-antibody complex formed in the microplate is then detected using an enzyme-linked secondary antibody, which produces a colorimetric signal that is directly proportional to the amount of EPO present in the sample.

The intensity of the color produced is measured using a spectrophotometer, and the concentration of EPO in the sample can be determined by comparing it to the standard or control sample of known EPO concentration. This allows for the accurate and precise measurement of EPO levels in a variety of samples, including serum, plasma, and cell culture supernatants.

Application of the Human EPO/Erythropoietin ELISA Kit

The Human EPO/Erythropoietin ELISA Kit has a wide range of applications in both basic research and clinical studies. In basic research, it is commonly used to study the regulation and function of EPO in various physiological and pathological conditions. For example, it can be used to measure the levels of EPO in response to hypoxia, or to investigate the role of EPO in diseases such as anemia and cancer.

In clinical studies, the Human EPO/Erythropoietin ELISA Kit is used to monitor the levels of EPO in patients with various disorders, such as chronic kidney disease and anemia. It can also be used to assess the effectiveness of EPO-based therapies or to screen for potential EPO deficiencies or abnormalities.

Conclusion

The Human EPO/Erythropoietin ELISA Kit is a valuable tool for studying the structure, function, and regulation of EPO in both basic research and clinical studies. Its high specificity, sensitivity, and accuracy make it a reliable method for quantifying EPO levels in various samples. With its wide range of applications, this ELISA kit is an essential tool for researchers and clinicians studying the role of EPO in human health and disease.

Keywords: Human EPO/Erythropoietin ELISA Kit, Erythropoietin, ELISA, antibody

There are no reviews yet.

Be the first to review “Human EPO/Erythropoietin ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products