Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD9 VHH (SAA0905)

Note:
For research use only. Not suitable for human use.

Original price was: €348.00.Current price is: €266.00.

50ug 24% OFF + 266 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD9 VHH (SAA0905)

Product name ARO-A16469-100
Uniprot ID P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Motility-related protein, anti-Leukocyte antigen MIC3, anti-TSPAN29, anti-Cell growth-inhibiting gene 2 protein, anti-CD9, anti-MIC3, anti-p24, anti-Tspan-29, anti-MRP-1, anti-5H9 antigen, anti-Tetraspanin-29, anti-CD9 antigen
Reference ARO-A16469
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD9
Clone Name SAA0905
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16469-1MG
Uniprot ID P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Motility-related protein, anti-Leukocyte antigen MIC3, anti-TSPAN29, anti-Cell growth-inhibiting gene 2 protein, anti-CD9, anti-MIC3, anti-p24, anti-Tspan-29, anti-MRP-1, anti-5H9 antigen, anti-Tetraspanin-29, anti-CD9 antigen
Reference ARO-A16469
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD9
Clone Name SAA0905
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16469-50
Uniprot ID P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Motility-related protein, anti-Leukocyte antigen MIC3, anti-TSPAN29, anti-Cell growth-inhibiting gene 2 protein, anti-CD9, anti-MIC3, anti-p24, anti-Tspan-29, anti-MRP-1, anti-5H9 antigen, anti-Tetraspanin-29, anti-CD9 antigen
Reference ARO-A16469
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD9
Clone Name SAA0905
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human CD9 VHH (SAA0905)

SDS-PAGE for Anti-Human CD9 VHH (SAA0905)

Anti-Human CD9 VHH (SAA0905), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD9 VHH (SAA0905)

There are no reviews yet.

Be the first to review “Anti-Human CD9 VHH (SAA0905)”

Your email address will not be published. Required fields are marked *

Related products

  • Lorvotuzumab Biosimilar - Anti-NCAM1, CD56 mAb binds to CD56 Recombinant Protein in indirect ELISA Assay
    Original price was: €369.00.Current price is: €284.00.
    View Product

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products