Brand: ProteoGenix

Anti-Human CD275/ICOSLG Antibody (SAA0089), PE

ARO-A10725-50
Validated FC

Clonality:: Monoclonal Antibody
Host species:: Human
Isotype:: IgG2, kappa
Target species:: Human
Clone Name:: SAA0089

Original price was: €435.00.Current price is: €354.00.

50ug 19% OFF + 354 loyalty points

Size Size

50ug Original price was: €435.00.Current price is: €354.00.
100ug Original price was: €657.00.Current price is: €505.00.
1MG Original price was: €2,051.00.Current price is: €1,465.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human CD275/ICOSLG Antibody (SAA0089), PE

Product name	ARO-A10725-100
Uniprot ID	O75144
Raw Antigen Sequence	MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference	ARO-A10725
Note	For research use only.
Isotype	IgG2, kappa
Clonality	Monoclonal Antibody
Target	B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name	SAA0089
Target species	Human

Product name	ARO-A10725-1MG
Uniprot ID	O75144
Raw Antigen Sequence	MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference	ARO-A10725
Note	For research use only.
Isotype	IgG2, kappa
Clonality	Monoclonal Antibody
Target	B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name	SAA0089
Target species	Human

Product name	ARO-A10725-50
Uniprot ID	O75144
Raw Antigen Sequence	MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference	ARO-A10725
Note	For research use only.
Isotype	IgG2, kappa
Clonality	Monoclonal Antibody
Target	B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name	SAA0089
Target species	Human

Datasheet

Flow Cytometry results for Anti-Human CD275/ICOSLG Antibody (SAA0089), PE

Flow-cytometry using PE anti-human CD275 antibody. U937 cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD275 monoclonal antibody (Catalog: ARO-A10725, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD275/ICOSLG Antibody (SAA0089), PE”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *