Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Prezalumab Biosimilar – Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb – Research Grade

  • PX-TA1417-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: €188.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb - Research Grade

Product name Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb - Research Grade
Uniprot ID O75144
Source CAS 1523164-68-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Prezalumab,AMG 557,MEDI-5872,ICOSLG, B7-H2, B7RP-1, CD275,anti-ICOSLG, B7-H2, B7RP-1, CD275
Reference PX-TA1417
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb - Research Grade
Uniprot ID O75144
Source CAS 1523164-68-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Prezalumab,AMG 557,MEDI-5872,ICOSLG, B7-H2, B7RP-1, CD275,anti-ICOSLG, B7-H2, B7RP-1, CD275
Reference PX-TA1417
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1417-50
Uniprot ID O75144
Source CAS 1523164-68-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Prezalumab,AMG 557,MEDI-5872,ICOSLG, B7-H2, B7RP-1, CD275,anti-ICOSLG, B7-H2, B7RP-1, CD275
Reference PX-TA1417
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

General information on Anti-ICOSLG/B7-H2/B7RP-1/CD275[Homo sapiens] (Prezalumab) Monoclonal Antibody

Prezalumab has been investigated for the treatment of Sjogren’s syndrome Cutaneous Lupus Erythematosus, Psoriasis, and Systemic Lupus Erythematosus (SLE).

SDS-PAGE for Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb

SDS-PAGE for Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb

Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Prezalumab Biosimilar - Anti-CD275;ICOSLG mAb - Research Grade

SEC-HPLC of Prezalumab Biosimilar - Anti-CD275;ICOSLG mAb - Research Grade

Prezalumab Biosimilar - Anti-CD275;ICOSLG mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb - Research Grade

There are no reviews yet.

Be the first to review “Prezalumab Biosimilar – Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products