Brand: ProteoGenix

Anti-Human CD14 Antibody (F1031), APC

ARO-A10272-50
Quality Chart

Clonality:: Monoclonal Antibody
Host species:: Human
Isotype:: IgG1
Target species:: Human
Clone Name:: F1031

Original price was: €104.00.Current price is: €85.00.

50ug 18% OFF + 85 loyalty points

Size Size

50ug Original price was: €104.00.Current price is: €85.00.
100ug Original price was: €150.00.Current price is: €122.00.
1MG Original price was: €478.00.Current price is: €354.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human CD14 Antibody (F1031), APC

Product name	ARO-A10272-100
Uniprot ID	P08571
Raw Antigen Sequence	MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14, RHC33702
Reference	ARO-A10272
Note	For research use only.
Isotype	IgG1
Clonality	Monoclonal Antibody
Target	Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14, RHC33702
Clone Name	F1031
Target species	Human

Product name	ARO-A10272-1MG
Uniprot ID	P08571
Raw Antigen Sequence	MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14, RHC33702
Reference	ARO-A10272
Note	For research use only.
Isotype	IgG1
Clonality	Monoclonal Antibody
Target	Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14, RHC33702
Clone Name	F1031
Target species	Human

Product name	ARO-A10272-50
Uniprot ID	P08571
Raw Antigen Sequence	MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14, RHC33702
Reference	ARO-A10272
Note	For research use only.
Isotype	IgG1
Clonality	Monoclonal Antibody
Target	Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14, RHC33702
Clone Name	F1031
Target species	Human