Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD14 (F1024D-D1D2) Monoclonal Antibody

  • ARO-A16038-50
  • Validated ELISA

Original price was: €351.00.Current price is: €274.00.

50ug 22% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD14 (F1024D-D1D2) Monoclonal Antibody

Product name ARO-A16038-100
Uniprot ID P08571
Uniprot link P08571
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14
Reference ARO-A16038
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD14 (F1024D-D1D2)
Clone Name F1024D-D1D2
Protein Name CD14 (F1024D-D1D2)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16038-1MG
Uniprot ID P08571
Uniprot link P08571
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14
Reference ARO-A16038
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD14 (F1024D-D1D2)
Clone Name F1024D-D1D2
Protein Name CD14 (F1024D-D1D2)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16038-50
Uniprot ID P08571
Uniprot link P08571
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14
Reference ARO-A16038
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD14 (F1024D-D1D2)
Clone Name F1024D-D1D2
Protein Name CD14 (F1024D-D1D2)
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD14 (F1024D-D1D2) Monoclonal Antibody

SEC-HPLC of Human CD14 (F1024D-D1D2) Monoclonal Antibody

Human CD14 (F1024D-D1D2) Monoclonal Antibody(ARO-A16176) was analyzed by size exclusion chromatography with UV detection.

SEC-HPLC of Human CD14 (F1024D-D1D2) Monoclonal Antibody

SEC-HPLC of Human CD14 (F1024D-D1D2) Monoclonal Antibody

Human CD14 (F1024D-D1D2) Monoclonal Antibodywas analyzed by size exclusion chromatography with UV detection.

Human CD14 (F1024D-D1D2) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD14 (F1024D-D1D2) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products