Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)

Note:
For research use only. Not suitable for human use.

380.00

100ug + 380 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)

Product name Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)
Uniprot ID Q15848
Raw Antigen Sequence MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Adiponectin, anti-ACRP30, anti-GBP28, anti-Adipose most abundant gene transcript 1 protein, anti-ACDC, anti-APM1, anti-ADIPOQ, anti-apM-1, anti-30 kDa adipocyte complement-related protein, anti-Adipocyte complement-related 30 kDa protein, anti-Adipocyte, anti-C1q and collagen domain-containing protein, anti-Gelatin-binding protein
Reference ARO-A16330
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen Adiponectin/ACRP30/ADIPOQ
Clone Name SAA1153
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)

SDS-PAGE for Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)

Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)

There are no reviews yet.

Be the first to review “Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products