Brand: ProteoGenix

Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)

ARO-A16330
Quality Chart

Note:: For research use only. Not suitable for human use.

€380.00

100ug + 380 loyalty points

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)

Datasheet

Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)

Product name	Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)
Uniprot ID	Q15848
Raw Antigen Sequence	MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human
Aliases /Synonyms	anti-Adiponectin, anti-ACRP30, anti-GBP28, anti-Adipose most abundant gene transcript 1 protein, anti-ACDC, anti-APM1, anti-ADIPOQ, anti-apM-1, anti-30 kDa adipocyte complement-related protein, anti-Adipocyte complement-related 30 kDa protein, anti-Adipocyte, anti-C1q and collagen domain-containing protein, anti-Gelatin-binding protein
Reference	ARO-A16330
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	Adiponectin/ACRP30/ADIPOQ
Clone Name	SAA1153
Target species	Anti-Human Monoclonal Antibody

Datasheet

SDS-PAGE for Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153)

Anti-Human Adiponectin/ACRP30/ADIPOQ VHH (SAA1153), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.