Cart (0 Items)
Your cart is currently empty.
View ProductsAlpha-synuclein(SNCA)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Alpha-synuclein(SNCA) |
|---|---|
| Uniprot ID | P37840 |
| Uniprot link | https://www.uniprot.org/uniprot/P37840 |
| Expression system | Prokaryotic expression |
| Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Molecular weight | 14.46 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Met1-Ala140 |
| Protein Accession | P37840 |
| Spec:Entrez GeneID | 6622 |
| Spec:NCBI Gene Aliases | NACP; PARK1; PARK4 |
| Spec:SwissProtID | Q13701 |
| NCBI Reference | P37840 |
| Aliases /Synonyms | Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP,NACP, PARK1 |
| Reference | PX-P4717 |
| Note | For research use only |
Related products
Biosimilar
Prasinezumab Biosimilar – Anti-SNCA mAb – Research Grade
PX-TA1491 400€
Biosimilar
Cinpanemab Biosimilar – Anti-SNCA mAb – Research Grade
PX-TA1573 400€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.